PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g010370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TCP
Protein Properties Length: 241aa    MW: 25484.2 Da    PI: 10.5293
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g010370.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.69.4e-382699276
             TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceae 76
                    a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++ +
  Csa13g010370.1 26 AVKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFST-A 99
                    79**************************************************************999997772.2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.2093286IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-3132105IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MANNDGAVAN GVIIEQTTSN KGPLNAVKKP PSKDRHSKVD GRGRRIRMPI ICAARVFQLT  60
RELGHKSDGQ TIEWLLRQAE PSIIAATGTG TTPASFSTAS LATSSPFTLG KRVVRAEEGE  120
SNGGGGGGVG GLTVGHTMGT SLMSGGGSAG FWAVPARPDF GQVWSFAAGA PPEMVFAQQQ  180
QPATLFVIKL PRPQQLQWVR LQQLELGIIY RVIIISICLL LCRVELTGRV GEKTTTTHVE  240
*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of the circadian clock. Acts as a repressor of CCA1 by binding to its promoter. No binding to the LHY promoter. {ECO:0000269|PubMed:19286557}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa13g010370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4120740.0AF412074.1 Arabidopsis thaliana AT5g08330/F8L15_60 mRNA, complete cds.
GenBankAL3921740.0AL392174.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F8L15 (ESSA project).
GenBankAY0726200.0AY072620.1 Arabidopsis thaliana AT5g08330/F8L15_60 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288561.11e-114transcription factor TCP21
SwissprotQ9FTA21e-102TCP21_ARATH; Transcription factor TCP21
TrEMBLR0GX401e-113R0GX40_9BRAS; Uncharacterized protein
STRINGCagra.1365s0040.1.p1e-114(Capsella grandiflora)
STRINGXP_006288561.11e-114(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.14e-74TCP family protein
Publications ? help Back to Top
  1. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  2. Ng DW,Chen HH,Chen ZJ
    Heterologous protein-DNA interactions lead to biased allelic expression of circadian clock genes in interspecific hybrids.
    Sci Rep, 2017. 7: p. 45087
    [PMID:28345627]
  3. Lee CM, et al.
    Decoys Untangle Complicated Redundancy and Reveal Targets of Circadian Clock F-Box Proteins.
    Plant Physiol., 2018. 177(3): p. 1170-1186
    [PMID:29794020]