PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g010080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TCP
Protein Properties Length: 271aa    MW: 30778.2 Da    PI: 7.0337
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g010080.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP88.71.3e-2748115370
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                     g+kdrhsk+ T +g RdRR+Rls+ +a++++dLq++LG+ ++sk i+WLl++ak  ++ l+ +++++ 
  Csa13g010080.1  48 GGKDRHSKVFTVRGIRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEAAKNDVDLLPPLQFPPG 115
                     78***********************************************************9977665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.37349107IPR017887Transcription factor TCP subgroup
PfamPF036344.9E-2649158IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDMRLNPSRE DMIRFKQEVE DHNQPSSLSL SRQRWNNPRI VRVSRTFGGK DRHSKVFTVR  60
GIRDRRIRLS VMTAIQVYDL QERLGLSQPS KVIDWLLEAA KNDVDLLPPL QFPPGFHQVI  120
SPNLNGLGES FPRVFESFDL GGCSNRENLD LEKMKWVKFD QDRNLDHGFD IDHHDHNVSN  180
SIQSNKFYIP TSTTTSSSSS YHYNLGHLQQ SLLDQSGNVT VAFSNNSNLN PPAVETVSSL  240
FPRYPSFIGG GQLQLFSENS NSSNQTDRVE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A7e-1854108155Putative transcription factor PCF6
5zkt_B7e-1854108155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa13g010080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3576121e-101AL357612.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T22D6 (ESSA project).
GenBankBT0299951e-101BT029995.1 Arabidopsis thaliana At5g08070 mRNA, complete cds.
GenBankCP0026881e-101CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019090313.10.0PREDICTED: transcription factor TCP17-like
SwissprotQ9LEZ91e-120TCP17_ARATH; Transcription factor TCP17
TrEMBLR0H8V51e-143R0H8V5_9BRAS; Uncharacterized protein
STRINGXP_010452780.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.11e-117TCP domain protein 17
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]