PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g056900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 643aa    MW: 70157.3 Da    PI: 5.5046
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g056900.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.9e-16339377240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Csa12g056900.1 339 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 377
                     689**********************************96 PP

2TCR51.22.5e-16424463140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkNk 
  Csa12g056900.1 424 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNKF 463
                     589***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.2E-19338379IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.465339464IPR005172CRC domain
PfamPF036386.1E-12341376IPR005172CRC domain
SMARTSM011143.2E-17424465IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11426462IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
SPCGRDSTTE LSLVPYAPTQ GGNGSCEGSG TELQQKMYDN VQGKTETPDW ESLISDASEL  60
LIFDSPDASE AFRCFMMQRA STSEARFNTG VGMQTMQPDA NKKPESSDAI PYEAVSFLHR  120
GIRRRCLDFE MPGNKQTLSE NNTAACESSS RCIVPSIGLH LNAIAMSSKD CKTNVTQDYS  180
CSGNIQVGLQ SSISSTLQET LDQTENETRE DADQDVPVEP ALQELNLSSP KKKSENNTAA  240
CESSSRCIVP SIGLHLNAIA MSSKDCKTNV TQDYSCSGNI QVGLQSSISS TLQETLDQTE  300
NETREDADQD VPVEPALQEL NLSSPKKKRV KLDSGEGDSC KRCNCKKSKC LKLYCECFAA  360
GVYCIEPCSC IDCFNKPIHE DTVLATRKQI ESRNPLAFAP KVIRNSDSVL ETGDDASKTP  420
ASARHKRGCN CKKSNCLKKY CECYQGGVGC SINCRCEGCK NKFGRKDGSS ISDMEAEQED  480
ENETSEKNRT AKSQQKTEFL MRKEASSALP TTPTPDYRQE LVQLLPFSSS KNRMPPPQSL  540
LGGGSSSGIF DSQYIRKPDI NLTQSRREKP FENVADDRAE DMPEVLIHSP IPNIKSVSPN  600
GKRVSPPHME SSSSGSISGR RSGGRKLILQ SIPSFPSLTP QH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1734146112120Protein lin-54 homolog
5fd3_B5e-1734146112120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324331PKKKRVKL
2324332PKKKRVKLD
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa12g056900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615391e-134AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026871e-134CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973371e-134Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019089594.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
RefseqXP_019089595.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_010449996.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]