PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g020500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 601aa    MW: 63788.6 Da    PI: 8.0525
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g020500.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14130169141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Csa12g020500.1 130 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 169
                     589**************************.********986 PP

2TCR513e-16215254140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Csa12g020500.1 215 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCLDCKNFE 254
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16130170IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.484131255IPR005172CRC domain
PfamPF036387.5E-11132167IPR005172CRC domain
SMARTSM011141.8E-19215256IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12218253IPR005172CRC domain
PROSITE profilePS500078.601245308IPR000909Phosphatidylinositol-specific phospholipase C, X domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0005525Molecular FunctionGTP binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MAEGGGGGEF PPKKDGVEEG FPAKNPARQL DFTGGSDEHS LSKAPAATAA PTVAATASVK  60
PIVNTPTVPS TIRPGMTIAI GQVRPTLPVA TTQILPSQAL ILNAPIRHPM PESPIARPRP  120
IVEARDGTPQ KKKQCNCKHS RCLKLYCECF ASGTYCDGCN CVNCFNNVDN EPARREAVEA  180
TLDRNPYAFR PKIASSPHGA RDKREDVGEV VLLGKHNKGC HCKKSGCLKK YCECFQANIL  240
CSENCRCLDC KNFEGSEERQ ALFHGEHANH LTYLQQAANA AITGAVGSSG FAPSPAPKRR  300
KGQDILFNQA TKGQFPQVNS GRTTGPGTSP SPVSRAGGNA SSVPSKFVYR SLLADIIQPQ  360
DVKALCSVLV AVAGEAAKTF TDQRKEKENR VEDQTNTSLA SSAQDHSQDN KDAADVEMVA  420
ADGNQADKSG PDDSNSDGAD ASKAKPLSPA TLALMCDEQD TIFMVSAAPP NGSVDPGGCG  480
TNSQGQSEIY AEQEKVVLTK FRDCLSRLIS YAELKESKCL SLARRHLQPP ATATVKTENG  540
IQQQVPVVNG ASRTTSQPTV NKPQPMQLMN TTSSSPAAAT TTNTHHHHTK PPALSEKKDP  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-351232642132Protein lin-54 homolog
5fd3_B3e-351232642132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa12g020500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447903.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLR0H2810.0R0H281_9BRAS; Uncharacterized protein
STRINGXP_010447903.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein