PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g016180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family WRKY
Protein Properties Length: 509aa    MW: 56363.2 Da    PI: 6.1687
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g016180.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.11.2e-25180236259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +e+s++ +kvvei+++g H he
  Csa12g016180.1 180 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECFAKK-IECSNDSGKVVEIVNKGLHSHE 236
                     7********************************98.*********************8 PP

2WRKY98.34.9e-31374431259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  Csa12g016180.1 374 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENTTAVIITYKGVHNHD 431
                     5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182909.42E-20176238IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.7E-20176238IPR003657WRKY domain
SMARTSM007747.5E-24179237IPR003657WRKY domain
PfamPF031066.1E-17181235IPR003657WRKY domain
PROSITE profilePS5081116.972181238IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.8E-32358433IPR003657WRKY domain
PROSITE profilePS5081132.156368433IPR003657WRKY domain
SuperFamilySSF1182904.45E-27369433IPR003657WRKY domain
SMARTSM007743.6E-35373432IPR003657WRKY domain
PfamPF031069.5E-24375431IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MEDSGIDETE VFYAVEKKST ASTEESEKVE PEKELDNGMS QLRDEDESLE TIGEDMYDLH  60
DEPVQETLDK DQVEEGVREN SSVEPNGEYV KEMDSVKETV VSAIVPVDAV EDDREVEASP  120
CLTASSDSLT MKPSLSSDPA AASAVQGLSM VSVPSKQEQR SDSPVVNRLS VSPVPRTPAR  180
DGYNWRKYGQ KQVKSPKGSR SYYRCTYSEC FAKKIECSND SGKVVEIVNK GLHSHEPPRK  240
NSFAPREIRV ASAIRPVSEN NAVVKEATIV PNGSDPSAST RENICEPQTF VERKTHCGNE  300
AVDEPEAKRR QVCFNFLISL PTIIHFKRCD INRLYFWVCF RLKKDNSQSS DSVSKPGKKN  360
KFVVHAAGDV GICGDGYRWR KYGQKMVKGN PHPRNYYRCT SAGCPVRKHI ETAVENTTAV  420
IITYKGVHNH DMPVPKKRHG PPSSMLVAAA APTSMRTRTD DQVNIPTSSQ CLVGRESEKK  480
SEALDVGGEK VMESARTLLS IGFEIKQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-25360433174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447641.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLR0GNC40.0R0GNC4_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32