PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g099790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Dof
Protein Properties Length: 422aa    MW: 45252.3 Da    PI: 8.5445
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g099790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.3e-39120179362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  Csa11g099790.1 120 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 179
                     6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-35108173IPR003851Zinc finger, Dof-type
PfamPF027011.4E-32121177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761123177IPR003851Zinc finger, Dof-type
PROSITE patternPS013610125161IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
LIHIPTPKLL LAFSSHFSSP PSPSLSLDFV QQLLLKFSLS PKLNNQTKHK MGLTSLQVCM  60
DSDWLQEAES SGGSMLDSST TSPSAADILA ACSTRPQASA VAVAAAALMD GGRRLRPPHD  120
HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG GCRKNKKPSS  180
SNSSSSTSSG KKPSNIITTN TTDLMALAHS HQNYQTSPLG FSHFGGLMGS YSTPEHSNVG  240
FLESKYGGLL SQSPRPIDFL DSKFDLMGVN NDNLVMVDHG SNGDHHHHHN NHHMGLHHGL  300
GLNNNNGGFN GISPGSNGNG GGLMDISACQ RLMLSSYDHQ HYNHQEDHQR VTTITDVKPN  360
PKLLSLDWQQ DQCYSNGGGN GGVGKSDGGG YGGGGYINGL GSSWNGLMNG YGSSTKTNSL  420
V*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa11g099790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289920.0AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010444159.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-180DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLD7MNC90.0D7MNC9_ARALL; Uncharacterized protein
STRINGXP_010444159.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-175Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]