PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g094280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 727aa    MW: 80299.2 Da    PI: 6.111
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g094280.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3314.5e-10171234159
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgry 59 
                     f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr  +g+ 
  Csa11g094280.1 171 FCKTLTASDTSTHGGFSVPRRAAEDCfspldyK-QQRPSQELIAKDLHGVEWKFRHIYRDEDGEL 234
                     99****************************963.3445679*****************9888774 PP

2Auxin_resp119.82.1e-39265346182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+stks+F+v+Y+Pra+++eFv+++ek+ +++++++++G+Rf+m+fe+++s+err++G+v+gv dldp+rWpnSkWr+ 
  Csa11g094280.1 265 VANAVSTKSMFHVFYSPRATHAEFVIPYEKYITSIRNPICIGTRFRMRFEMDESPERRCAGVVTGVCDLDPYRWPNSKWRCF 346
                     689*****************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.3E-21162235IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.23E-27165230IPR015300DNA-binding pseudobarrel domain
CDDcd100178.57E-10169237No hitNo description
PfamPF023623.7E-8171233IPR003340B3 DNA binding domain
PfamPF065073.4E-33265346IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MEFDLNTEIA EVEEEENDDV VGARIIDKGT LGISPSSSSS CSSGSSSSST GSASSIYSEL  60
WHACAGPLTC LPKKGNVVVY FPQGHLEQDA LVSYSSPLEI PKFDLNPQIF CRVVNVQLLA  120
NKVTDEVYTQ VTLLPLQEFS MLNAEGKEVR ELGGEEERNG SSSVKRTPHM FCKTLTASDT  180
STHGGFSVPR RAAEDCFSPL DYKQQRPSQE LIAKDLHGVE WKFRHIYRDE DGELRLGIRR  240
AARPRNGLPD SIIEKNSCSN ILSFVANAVS TKSMFHVFYS PRATHAEFVI PYEKYITSIR  300
NPICIGTRFR MRFEMDESPE RRCAGVVTGV CDLDPYRWPN SKWRCFLVRW DESFVSDHQE  360
RVSPWEIDPS VSLPHLSIQS SPRPKRPWAG LLDTTPPGNP LTAERGGFLD FEESVRPSKV  420
LQGQENIGSA SPSQGFDVMN RRILDFAMQS HANPVLLSSR VKDRFGEFVD ATSLDPACSG  480
VMDLDRFPRV LQGQEICSLK SFPQFAGFSP AATSGKPSLG YTDPFAYQAN KSSFYPLALH  540
GIRSTHVPYQ NPYTAGNQSP GHPSRAINFG EVTRKSDAVN ESGLPSNVTA DLPFKIDMMG  600
KQKGGDFSMN VSSGCKLFGF SLPVETPASN PQGSSKRICT KVHKQGSQVG RAIDLSRLNG  660
YDDLLTELER LDFCNVVWKI HLYTKDEVEN ANDDNKSCLE QAALMMEASK SSSVSQPDSS  720
PTITRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A3e-86443692354Auxin response factor 1
4ldw_A3e-86443692354Auxin response factor 1
4ldw_B3e-86443692354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa11g094280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0134660.0AF013466.1 Arabidopsis thaliana auxin response factor 4 (ARF4) mRNA, complete cds.
GenBankAF3443130.0AF344313.1 Arabidopsis thaliana auxin response factor 4 (At5g60450) mRNA, complete cds.
GenBankAY0808320.0AY080832.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
GenBankAY1139770.0AY113977.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010443845.10.0PREDICTED: auxin response factor 4-like
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLD7MTU60.0D7MTU6_ARALL; Auxin response factor
STRINGXP_010443845.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]