PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g060110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family WRKY
Protein Properties Length: 179aa    MW: 20873.6 Da    PI: 8.3226
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g060110.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.6e-3396154159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+
  Csa11g060110.1  96 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGMHNHP 154
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-3283154IPR003657WRKY domain
SuperFamilySSF1182901.16E-2888155IPR003657WRKY domain
PROSITE profilePS5081129.05791156IPR003657WRKY domain
SMARTSM007742.4E-3896155IPR003657WRKY domain
PfamPF031062.0E-2697154IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MEREDINRML NLDVENNNTF SSFVDKTLMM IPPLTFTGEV EPCSSWYPES FDVHVPPPAP  60
ENDHQIGEKG KNKEKEKRSR KVPRIAFHTR SDDEVLDDGY RWRKYGQKSV KNNAHPRSYY  120
RCTYHTCNVK KQVQRLAKDP NVVVTTYEGM HNHPCEKLME TLNPLLRQLQ FLSSFSNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2686153774Probable WRKY transcription factor 4
2lex_A7e-2686153774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa11g060110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4048641e-168AF404864.1 Arabidopsis thaliana WRKY transcription factor 24 (WRKY24) mRNA, complete cds.
GenBankAK2275221e-168AK227522.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-13-N18.
GenBankBT0045951e-168BT004595.1 Arabidopsis thaliana At5g41570 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441322.11e-133PREDICTED: probable WRKY transcription factor 24
SwissprotQ9FFS31e-110WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLD7MIT91e-107D7MIT9_ARALL; Uncharacterized protein
STRINGXP_010441322.11e-133(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.19e-94WRKY DNA-binding protein 24