PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g059580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TCP
Protein Properties Length: 229aa    MW: 24973.5 Da    PI: 10.5445
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g059580.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP108.11.3e-3348128283
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                      +kk++++++h kv+gR+RRvRl+++caar+++L++eLG+++d++tieWLlqqa+p+i+ +tg++ ++  ++ +es ++s+ 
  Csa11g059580.1  48 QKKKKPNKDRHLKVEGRGRRVRLPVLCAARIYQLTKELGLKSDGETIEWLLQQAEPSIISATGNGIKPVGAT-TESVVVSQP 128
                     579*************************************************************77776333.333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.79454108IPR017887Transcription factor TCP subgroup
PfamPF036343.5E-2654121IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MNNDKNRKQT VVKGFDIVVG DKELKRKTKT KEKEKEEQQQ IQLLGEEQKK KKPNKDRHLK  60
VEGRGRRVRL PVLCAARIYQ LTKELGLKSD GETIEWLLQQ AEPSIISATG NGIKPVGATT  120
ESVVVSQPRP LLTADLMVGH HNTQGGAPTP RSQMAANGLL RWMNETWQNT TQRLFDLNCG  180
FGFGFKGVSE MGFGNNPRPG LELGLSHGSG NVGGFVSAGL SANGSRTV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa11g059580.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019087527.11e-138PREDICTED: LOW QUALITY PROTEIN: transcription factor TCP6-like, partial
SwissprotQ9FLM68e-69TCP6_ARATH; Transcription factor TCP6
TrEMBLD7MIZ93e-77D7MIZ9_ARALL; Uncharacterized protein
STRINGXP_010445711.11e-138(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157431416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41030.12e-65TCP family protein
Publications ? help Back to Top
  1. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]