PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g037100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 689aa    MW: 75474.1 Da    PI: 5.7326
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g037100.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93.1e-16385423240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Csa11g037100.1 385 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 423
                     689**********************************96 PP

2TCR51.12.7e-16470509140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkNk 
  Csa11g037100.1 470 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNKF 509
                     589***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.2E-19384425IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.465385510IPR005172CRC domain
PfamPF036386.6E-12387422IPR005172CRC domain
SMARTSM011143.2E-17470511IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-11472508IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPNSKSRF EDSPVFNYIN SLSPIRPVKS IQNPHQFSSL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHNSS SSSSHPTNPT ESREDESTSN ESVSEEAAED TKDVNVDDAS  120
KPEETSVEKV LPQTNPGSPV ASPYGRDSTT ELSLVPYAPT QGGNGSCEGA GMELQPKMFD  180
NVQGKTETPD WESLISDASE LLIFDSPDAS EAFRCFMMQR ASTSEARFNT GVGMQTMQPD  240
ANKKLESSDA IPYEAVSFLH RGIRRRCLDF EMPGNKQTLS ENNTAACESS SRCIVPSIGL  300
HLNAIAMSSK DCKTNVTQDY SCSGNIQVGL QSSISSTLQE TLDQTENETR EDADQDVPVE  360
PALQELNLSS PKKKRVKLDS GEGDSCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCIDCF  420
NKPIHEDTVL ATRKQIESRN PLAFAPKVIR NSDSVLETGD DASKTPASAR HKRGCNCKKS  480
NCLKKYCECY QGGVGCSINC RCEGCKNKFG RKDGSSIVDM EAEQEEENET SEKYRTAKSQ  540
QNTEFLMRKE ASSALPTTPT PIYRQELVEL LPFSSSKNRM PPPQSLLGGG SSSGIFNSQY  600
IRKPDIDLTQ SRMEKSFETV AEDRAEEMPE ILIHSPIPNI KSVSPNGKRV SPPHMESSSS  660
GSISGRRSGG RKLILQSIPS FPSLTPQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1738950714120Protein lin-54 homolog
5fd3_B8e-1738950714120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1370377PKKKRVKL
2370378PKKKRVKLD
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa11g037100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615391e-136AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026871e-136CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973371e-136Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010440393.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_010440393.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]