PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g014570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 626aa    MW: 66675.9 Da    PI: 8.2106
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g014570.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14129168141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Csa11g014570.1 129 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 168
                     589**************************.********986 PP

2TCR50.93.1e-16214253140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Csa11g014570.1 214 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCLDCKNFE 253
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16129169IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.456130254IPR005172CRC domain
PfamPF036387.9E-11131166IPR005172CRC domain
SMARTSM011141.8E-19214255IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-12217252IPR005172CRC domain
PROSITE profilePS500078.601244307IPR000909Phosphatidylinositol-specific phospholipase C, X domain
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MAEGGGGGEF PPKKDGVEEG FPAKNPARQL DFTGGSDEHS LSKAPAATAA PTVAATAAVR  60
PIVTPTVPST IRPGMTIAIG QVRPTLPVAT TQILPSQALI LNAPNRHPNP ESPIARPRPI  120
VEARDGTPQK KKQCNCKHSR CLKLYCECFA SGTYCDGCNC VNCFNNVDNE PARREAVEAT  180
LDRNPFAFRP KIASSPHGAR DKREDIGEVV VLGKHNKGCH CKKSGCLKKY CECFQANILC  240
SENCRCLDCK NFEGSEERQA LFHGEHANHM TYLQQAANAA ITGAVGSSGF APSPAPKRRK  300
GQDILFNQAT KDSSRLGQFP QVNSGRTTGP GTSPSPVSRA GGNASSVPSK FVYRSLLADI  360
IQPQDVKALC SVLVAVAGEA AKTLTGKNSS NNSVLLRFID LPFKIFSDQR KEKENRVEDQ  420
TDTSLASSAQ DHSQENKDAA DVEMVAADGN QADKSGPDDS NSDGADASKA KPLSPATLAL  480
MCDEQDTIFM VSAAPPNGSV DPRGCGTNSQ SQSEIYAEQE KVVLTKFRDC LSRLISYAEL  540
KESKCSSLAR RHLQPPATAT VKTENGIQQQ VPVVNGASRT TSQPTVNKPQ PMQLMNTTSA  600
AAAVATTNTH HHHNKPPALS EKKDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-3213126311132Protein lin-54 homolog
5fd3_B5e-3213126311132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa11g014570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010438363.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLR0H2810.0R0H281_9BRAS; Uncharacterized protein
STRINGXP_010438363.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein