PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g033170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 325aa    MW: 37399.8 Da    PI: 6.869
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g033170.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.55.6e-16949343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    +en+  r  t+ +Rr+g+l K +ELS+LCd+ v++iifs++
  Csa10g033170.1  9 VENDKARALTLKRRREGLLRKVKELSILCDIWVCLIIFSPN 49
                    69*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR004043.3E-7121IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.526149IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-16158IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-20291IPR002100Transcription factor, MADS-box
CDDcd002664.05E-24383No hitNo description
PfamPF003191.6E-14949IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-72136IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-73657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSKLKLAWVE NDKARALTLK RRREGLLRKV KELSILCDIW VCLIIFSPNE VEPVVWPSAE  60
RARDLLNDFF ALPKFEQKNK ETSVESFLKK KTEAVHKQLM KSNKKTKEYV TDELMLHLQH  120
GRGIEDLNLT EIYALLSYSK EKILLCRKKS NFMKFSPLRD PLVLPSEVKV KQLTITTNDS  180
FVGGVQDDDK TEFDPKPLEH VSHCPYQGSS SNGNASLEME PIYPFVTCFH GLVGSASQQL  240
QHRNMTNNPI LAMNQPKQYL FDFMSREQEI EEEKNNINTQ IYRGNNTMTT NNNACQEPPL  300
SETTVREDNV NLMSLDIDRD WLSL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa10g033170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010436630.10.0PREDICTED: agamous-like MADS-box protein AGL92
TrEMBLR0HWZ51e-129R0HWZ5_9BRAS; Uncharacterized protein
STRINGXP_010436630.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.12e-98AGAMOUS-like 48