PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g013610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 605aa    MW: 64298.2 Da    PI: 7.9662
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g013610.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14127166141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Csa10g013610.1 127 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 166
                     589**************************.********986 PP

2TCR50.93e-16212251140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Csa10g013610.1 212 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCLDCKNFE 251
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16127167IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.513128252IPR005172CRC domain
PfamPF036387.6E-11129164IPR005172CRC domain
SMARTSM011141.8E-19212253IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-12215250IPR005172CRC domain
PROSITE profilePS500078.601242305IPR000909Phosphatidylinositol-specific phospholipase C, X domain
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MAEGGGGGEF PPKKDGVEEG FPAKNPARQL DFTGGSDEHS LSKAPAAPPT VVATPAVKPI  60
VTPTVPSTIR PGMTIAIGQV RPTLPVATTQ ILPSQALILN APIRHPNPES PIARPRPIVE  120
ARDGTPQKKK QCNCKHSRCL KLYCECFASG TYCDGCNCVN CFNNVDNEPA RREAVEATLD  180
RNPFAFRPKI ASSPHGARDK REDIGEVVLS GKHNKGCHCK KSGCLKKYCE CFQANILCSE  240
NCRCLDCKNF EGSEERQALF HGEHANHMTY LQQAANAAIT GAVGSSGFAP SPAPKRRKGQ  300
DILFNQATKD SSRLGQFPQV NSGRTTGPGT SPSPVSRAGG NASSVPSKFV YRSLLADIIQ  360
PQDVKALCSV LVAVAGEAAK TLTDQRKEKE NRVEDQTDTS LASSAQDHSQ ENKDAADVEM  420
VAADGNQADK SGPDDSFSDG ADASKAKPLS PATLALMCDE QDTIFMVSAA PPNGSVDPRG  480
CGTNSQSQSE IYAEQEKVVL TKFRDCLSRL ISYAELKESK CSSLARRHLQ PPATATVKTE  540
NGIQQQVPVV NGASRATSQP TVNKPQPMQL MNTTSSSAAA AAVATTNTHH HHNKPPALSE  600
NKDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-3212926111132Protein lin-54 homolog
5fd3_B5e-3212926111132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa10g013610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010433149.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLR0H2810.0R0H281_9BRAS; Uncharacterized protein
STRINGXP_010433149.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein