PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g011590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family WRKY
Protein Properties Length: 477aa    MW: 52301.2 Da    PI: 6.5193
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g011590.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.21.1e-25180236259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +e+s++ +kvvei+++g H he
  Csa10g011590.1 180 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECFAKK-IECSNDSGKVVEIVNKGLHSHE 236
                     7********************************98.*********************8 PP

2WRKY98.44.5e-31340397259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  Csa10g011590.1 340 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENTTAVIITYKGVHNHD 397
                     5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182908.63E-20176238IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.1E-20176238IPR003657WRKY domain
SMARTSM007747.5E-24179237IPR003657WRKY domain
PfamPF031065.5E-17181235IPR003657WRKY domain
PROSITE profilePS5081116.972181238IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-32324399IPR003657WRKY domain
PROSITE profilePS5081132.156334399IPR003657WRKY domain
SuperFamilySSF1182904.05E-27335399IPR003657WRKY domain
SMARTSM007743.6E-35339398IPR003657WRKY domain
PfamPF031068.7E-24341397IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MENSGVDETE VFYAVEKSTA NTEKSEKVEP EKELDNGMSQ LRDDDESLGT IGEDMYDLHD  60
DAVRQTLDKD QVEGVRENSS VEPNGEDVRD DVKEMDSVKE TVVSAIVPVD EVEVDREVEA  120
SPCLTASSDS LTVKPSLSSD PASAAKGLSL VSIPTKQEQR SDSPVVNRLS VSPVPRTPAR  180
DGYNWRKYGQ KQVKSPKGSR SYYRCTYSEC FAKKIECSND SGKVVEIVNK GLHSHEPPRK  240
NSFSPREIRV ASAIRPISEN NAVVKEPTIV PNGSDPAAST RENICEPQTF VERKRHCGNE  300
AVDEPEAKRR QNSQSSDSVS KPGKKNKFVV HAAGDVGICG DGYRWRKYGQ KMVKGNPHPR  360
NYYRCTSAGC PVRKHIETAV ENTTAVIITY KGVHNHDMPV PKKRHGPPSS MLVAAAAPTS  420
MRTRTDDQVN IPTSSQCSGG RESEKKKSSE AVDVGGEKVM ESARTLLSIG FEIKQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-26326399174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0051100.0BT005110.1 Arabidopsis thaliana clone U20909 putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
GenBankBT0040860.0BT004086.1 Arabidopsis thaliana clone RAFL15-37-C10 (R20909) putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432924.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLR0GNC40.0R0GNC4_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32