PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g096270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GeBP
Protein Properties Length: 385aa    MW: 41369.8 Da    PI: 4.7876
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g096270.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573127.94.2e-40158250397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     f+rlw+eeDei++LqG+idfka+tgksp++d ++ y+f+kk isf+vsk+q+++K+r+L+kK+ +k+ k  +g epsf+k+hdqk++el+k iWg
  Csa09g096270.1 158 FHRLWTEEDEIAVLQGMIDFKADTGKSPYEDSNGYYDFIKKDISFEVSKNQFMDKLRSLRKKYMGKEVK--NGVEPSFAKPHDQKAYELAKTIWG 250
                     89***************************************************************9988..***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.6E-33158250IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MTKKLNPLED PPSASSSDDD DIETSEAGDP SDDSSSSEDD ESSKTPIKSL ASVAAAAAAA  60
ASSKSTVVAE SDSGSETETD SDSESTNPPN SGSGKTISVN LKKKEDPTSS TALALPAAKS  120
GGTKRPASEA AAAVTASANK RVKKGGGEEE SVKKPGGFHR LWTEEDEIAV LQGMIDFKAD  180
TGKSPYEDSN GYYDFIKKDI SFEVSKNQFM DKLRSLRKKY MGKEVKNGVE PSFAKPHDQK  240
AYELAKTIWG PDGIAATESN VKSNGVSKRS KAKKKLDSVK QELVYAGDDD GDDDDDDDMD  300
VVVHGRKSDL FVSSSLVRMI AGCGVDEYYV KRQWSLLPVE TKKVVEEKLK LLQAKELEFV  360
VEKSEFLHEV SSMIVEASKN KKSH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267273KRSKAKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010430191.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLQ9SYA91e-160Q9SYA9_ARATH; AT1G61730 protein
STRINGAT1G61730.11e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-100DNA-binding storekeeper protein-related transcriptional regulator