PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g092790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BES1
Protein Properties Length: 699aa    MW: 76843.2 Da    PI: 7.6112
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g092790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822215.31.4e-6621451149
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspessl 94 
                     ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ e++e++g sa+asp+ss+
  Csa09g092790.1   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCSRPvERMEIGGGSATASPCSSY 96 
                     5899**********************************************************************999****************** PP

          DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                     q        +sp++sy++sp+ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  Csa09g092790.1  97 Q--------PSPCASYNPSPASSNFMSPASSSFANLTSGdgQSLIPWLKHLSTTSSS 145
                     *........**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.9E-643140IPR008540BES1/BZR1 plant transcription factor, N-terminal
PfamPF144161.4E-17375426IPR025846PMR5 N-terminal domain
PfamPF138394.9E-89427693IPR026057PC-Esterase
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCSRPVER MEIGGGSATA SPCSSYQPSP CASYNPSPAS SNFMSPASSS  120
FANLTSGDGQ SLIPWLKHLS TTSSSSASSS SRLPNYLYIP GGSISAPVTP PLSSPTARTP  180
RMNTDWQQLN NSFFVSSTPP SPTRQIIPDS EWFSGIQLAQ SVPASPTFSL VSQNPFGFKE  240
EAASAAGCGG GSRMWTPGQS GTCSPAIPSG ADHTADVPMS EAVAPPEFAF GSNTNGLVKA  300
WEGERIHEES GSDDLELTLG NSSTSCNSQR KVDDESVSIH DPIYELIIIT WKTNKSLDYD  360
VLAYNTNAGY NNTSKCNIYE GRWIYDYTSN PLYGTSTCPF IGLDCQKLGR PDRNYLHYRW  420
QPSGCDIPRF DGQDFLARFK GKKILFVGDS LSNNMWVSMS CMLHAAVPNA KYTFDYNNKR  480
LSTFTIPEYG ISVNFLKNGF LVDLVADKTR GLILKLDSIS SGNQWLGADV AIFNTFHWWS  540
HTGRAKTWDY FQTGDQIVKE MNRMEAFKIA LTTWAKWIDH NIDPSKTRVF YQGVSPVHLN  600
GSEWGKPGKT CLGETEPLKG PSNNPGPNIG EAIVRRVIGG MAKPVELLDL TAMTELRKDA  660
HPSIYAGGGS RLNDCSHWCL PGVPDAWNQL LYTALLSH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-174BES1/BZR1 homolog 4