PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g062970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GeBP
Protein Properties Length: 388aa    MW: 41711.1 Da    PI: 4.8964
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g062970.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573126.51.1e-39150242397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     ++rlw+e+Dei++LqG+idfka+tgksp++d ++ y+f+kk isf+vsk+q+++K+r+L+kK+ +k+ k  +g epsf+k+hdqk++el+k+iWg
  Csa07g062970.1 150 SHRLWTEDDEIAVLQGMIDFKADTGKSPYEDSNGYYDFIKKDISFEVSKNQFMDKLRSLRKKYMGKEVK--NGVEPSFAKPHDQKAYELAKIIWG 242
                     68***************************************************************9988..***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.2E-32151242IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MTKKLNPLED PPSASSSDDD DIETSEAGEP SDDSSSSEDD ESSKAPIKSL ASAAAAAASS  60
KSTVVAESDS GSETETDSDS ESTNPPNSGS GKTISVNLKK KEDPTSSAAL ALPAAKSGGT  120
KRPASEAATA SANKRVKKGG EEESVKKPGS HRLWTEDDEI AVLQGMIDFK ADTGKSPYED  180
SNGYYDFIKK DISFEVSKNQ FMDKLRSLRK KYMGKEVKNG VEPSFAKPHD QKAYELAKII  240
WGPQGIATES NVKSNGVSKK SKAKKKLDSV KQELVYAGSS PNGKRDDDGD GDDDDDDMDL  300
VVHGGGGSRK SDLFESSSLV RMIAGCGVDE YYVKRQWSLL PVETKKVVEE KLKLLQAKEL  360
EFVMEKTDFL HEVTSMIVEA SKNKKSH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010418144.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLQ9SYA91e-163Q9SYA9_ARATH; AT1G61730 protein
STRINGAT1G61730.11e-163(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-91DNA-binding storekeeper protein-related transcriptional regulator