PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g050580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 378aa    MW: 42702 Da    PI: 6.612
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g050580.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-1191133446
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                     +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L 
  Csa07g050580.1  91 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELE 133
                     6899**************************8888887776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-483146IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.40490134IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-990134No hitNo description
PfamPF001706.1E-891133IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-792134No hitNo description
PROSITE patternPS00036095110IPR004827Basic-leucine zipper domain
PfamPF141441.0E-29179253IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MMSSSSPTQL ASLRDMGIYE PFQQIVGWGN VFKSDINDHS PNTATSSIIQ VDARVDDQNN  60
IKTNYASSSH NQIEAEPSSN DNQDDDGRIH DKMKRRLAQN REAARKSRLR KKAYVQQLEE  120
SRLKLSQLEQ ELEKVKQQGL CVRNSSNSSY LGAAGSINTG IASFEMEYSH WLEEQSRRVS  180
EIRIALQSHI SDIELRMLVE SCLNHYANLF RMKSNAAKAD VFYLISGMWR TSTERFFQWI  240
GGFRPSELLN VVMPYLQPLT DQQILEVRNL QQSSQQAEDA LSQGIDKLQQ SLAESIVVDA  300
VIESTDYPAH MAAAIENLQA LEGFVTQADH LRQQTLQQMA KILTTRQSAR GLLALGEYLH  360
RLRALSSLWA ARPREPT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g050580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416756.10.0PREDICTED: transcription factor TGA7-like isoform X1
RefseqXP_010416757.10.0PREDICTED: transcription factor TGA7-like isoform X1
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLR0GHF30.0R0GHF3_9BRAS; Uncharacterized protein
STRINGXP_010416756.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]