PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g047890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Nin-like
Protein Properties Length: 825aa    MW: 92092.4 Da    PI: 6.2172
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g047890.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29554605152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Csa07g047890.1 554 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 605
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2544625IPR003035RWP-RK domain
PfamPF020421.3E-25557605IPR003035RWP-RK domain
SuperFamilySSF542771.01E-22715812No hitNo description
SMARTSM006661.4E-23726809IPR000270PB1 domain
PROSITE profilePS5174525.729726809IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.5E-19727806No hitNo description
PfamPF005643.7E-17728807IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MENNSLPLDP AMDSSFMDGL LLEGCWLETT DAASELFNFS PSTSVTPFDP SSFMWSPTQQ  60
DTPPAAICSS SSLSQTMYGQ DCAERSSLED QGRDLSSFNR RWWIGPSGHG SSVMERLVQA  120
VAHIKDYTSE RGSLIQLWVP VDRGGKRVLT TKEQPFSHDP MCQRLAHYRE ISVNYQFSTE  180
QEDSGSNSND LVGLPGRVFL GKVPEWTPDV RFFKNEEYPR VQHAQDCDVR GTLAIPVFEQ  240
GSQNCLGVIE VVMTTQMVKL SPDLESICRA LQAVDLRSTG VPIPPSLKGP DFSYQAALPE  300
IRNLLRCACE THKLPLAQTW VSCLKQSKTG CRHNDENYIH CVSTIDDACY VGDPTVREFH  360
EACSEHHLLK GQGVVGEAFL TNGPCFSSDV SSYKKSEYPL SHHATMFGLH GTVAIRLRCI  420
HTGSADFVLE FFLPKSCRDI EEQRKMLNAL STIMAHVPRS LRTVTEKELE EEGNPMAREV  480
IERRVTLPKI ENPSEVQESN SNPQNAGLVF DGGTTEMGEL GSDYGKGISV NEKSTFSSAT  540
GGFSRITEKK RTKAEKNITL DVLRQYFAGS LKDAAKSIGV CPTTLKRICR QHGIQRWPSR  600
KIKKVGHSLQ KIQRVIDSVE GVSGHHLPIG SFYANFPNLA SSPEASSLQQ QQSKRTTFLF  660
SSTSQPTKSP GSSCSYSSSC SSETQVNKED PTDKTRQETT TLSRSFKERQ TTTHLSPSTS  720
SQEDDLLRIK VTYEEEKIRF RMRNSHRLND LLWEIAKRFS IEDVSRYDLK YLDEDNEWVL  780
LRCDDDVDEC VDVCRSFPGQ TIKLLLQLSS QYLSERSSAS GCPS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g047890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416548.10.0PREDICTED: protein NLP5
RefseqXP_010416549.10.0PREDICTED: protein NLP5
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLR0I6G00.0R0I6G0_9BRAS; Uncharacterized protein
STRINGXP_010416548.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein