PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g045840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41897.1 Da    PI: 6.5062
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g045840.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.94.6e-22950142
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    krie++snrq t+skRr gilKKA ELSvLCd+++ +++fs+
  Csa07g045840.1  9 KRIESSSNRQNTYSKRRSGILKKARELSVLCDIDIVLLMFSH 50
                    79**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.478149IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-24157IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-19152IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-15323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-181050IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRVKLMIKR IESSSNRQNT YSKRRSGILK KARELSVLCD IDIVLLMFSH LPEGLPHYMD  60
IMYWRCHFQV CAVDSSRKDK TALKKTFMKL DHDGNIKEFF VGSRNQTNVG LTNQVAFFQA  120
QVLECHRRLS RWTDIVRTEN IEHLEHFGES LRNSIERVQI HKGHFRKNQL LLLECTTTQF  180
HSGISSPLVI NGIQENHLIS WLPDNSYQQM IIPADSSFLP HHEMENTATA SLPVYSSFFE  240
SRIQEDQNCN LEQQLDRLRE EGNMLNELNG NSCSSLQLGE EYSYLTQFGM QEEKKLESGF  300
EFNFQQDLSM YPVSNSFQFP DQPVFAATDH HQTCSNPVFG HSDNNQVAET GTGTGIGYGN  360
GDGKR*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g045840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7056041e-147KF705604.1 Boechera sp. IPK Bsp 9 isolate BAC5_7 APOLLO gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428431.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X2
SwissprotQ7X9I01e-104AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A3P5YL321e-102A0A3P5YL32_BRACM; Uncharacterized protein
STRINGXP_010428430.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-103AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]