PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g015880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 358aa    MW: 41321.2 Da    PI: 6.28
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g015880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.78.1e-15951345
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    ien+  r   + +Rr+g+lKK +ELSvLCd+ + +iifs++  
  Csa07g015880.1  9 IENDKARARRLKQRREGLLKKVKELSVLCDITAFLIIFSPNEA 51
                    99*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.502149IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-6121IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-16158IPR002100Transcription factor, MADS-box
CDDcd002662.83E-24382No hitNo description
SuperFamilySSF554551.19E-17378IPR002100Transcription factor, MADS-box
PfamPF003191.4E-12950IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-62136IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-63657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAKVKLAWIE NDKARARRLK QRREGLLKKV KELSVLCDIT AFLIIFSPNE AVPMVWPSVE  60
MARGILDGFF ALPKFVQKQK ETIVKSILEE KIKTVHEQLM KSNEKKKEYV VDELMMRLQH  120
GRGFDDLNLS EIHVLLSFSK DKIILYRKKL NFMQFSTLRD PPVLPFEVQA EQLTITTNDA  180
FVGSGQDDDK NRKKDEEPRI FNIDTFKENK SYYLIDRWVL DPKPLEHVIY QQMRNDNPNF  240
VSYFPYQGSD SNGNASLEME PVSPQVMTFH GLVGSASQPL QHCNMTNNAI MAMNQPFDLM  300
SRVLERQDEG NNINNSEIYM TNNTATTNND VRQEPPPNEI TSREDIVNLS PFDINRN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11623RRLKQRRE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g015880.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010414495.10.0PREDICTED: MADS-box transcription factor 21-like
TrEMBLA0A178VQF21e-131A0A178VQF2_ARATH; AGL48
TrEMBLQ9XEF11e-131Q9XEF1_ARATH; AGAMOUS-like 48
STRINGXP_010414495.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-136AGAMOUS-like 48