PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g015790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 311aa    MW: 35763.6 Da    PI: 5.461
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g015790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF32.61e-101050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i+nk  r+ tf +R++g+ KK + L +LC+++v+ +i+ +
  Csa07g015790.1 10 FISNKVIRKRTFNRRKEGLKKKLNDLKTLCNVDVCAVIYNP 50
                    8************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-12160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.675149IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-17174IPR002100Transcription factor, MADS-box
CDDcd002662.10E-20278No hitNo description
PRINTSPR004041.5E-5323IPR002100Transcription factor, MADS-box
PfamPF003196.1E-131051IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAKKKLNLNF ISNKVIRKRT FNRRKEGLKK KLNDLKTLCN VDVCAVIYNP FNSTRDVWPS  60
ESGVNSVIER ALIMKEKKCE VLNHEEFLNQ FIEKVKIYEN KLVEDNKETR LKEVMFRCLG  120
GNMKDFKMND KDRSDLCEFI DGYLKNLYHH KKVNLNQPNY EIGETSSMQM ARTATTANMA  180
TDAVYVDMAP TDVSPFMAPP TMAEVSSSFL NAPFLNTPQP TNELQFIVSP NQTPGDMNSL  240
SMTLLNHVAD HVDFQISDNN QEVYIPSVDQ DEIHYPNQTY DGNQQGFIEE MIKYAEETNF  300
PWIVDNPNKF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g015790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010414491.20.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A178VYD31e-113A0A178VYD3_ARATH; AGL46
TrEMBLF4IIT61e-113F4IIT6_ARATH; AGAMOUS-like 46
STRINGXP_010513274.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.11e-111AGAMOUS-like 46