PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g021540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LBD
Protein Properties Length: 312aa    MW: 35235.5 Da    PI: 5.565
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g021540.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.71.7e-37361361101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nv++lFG++ ++k+l++l+e++r++am+s+++++ +r r Pv+G++gv ++lq  +  +++el+
  Csa06g021540.1  36 ACAACKYQRRRCASDCPLAPYFPAEQPKLFQNVRRLFGVRSIVKILERLDETQRPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWLAEEELK 130
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  Csa06g021540.1 131 AVNAQL 136
                     999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.72835136IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3436133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSHVKHIHKG SLERFLDLLL IALVVLMTLK GGTSGACAAC KYQRRRCASD CPLAPYFPAE  60
QPKLFQNVRR LFGVRSIVKI LERLDETQRP EAMKSIIFQS YVRDRSPVHG CLGVTQQLQY  120
MIWLAEEELK AVNAQLQLYR SQNDGQNQQN HNQMMINDLG VVVDNKQQQD DVTSQLDLGM  180
GLNVNNNQSS VVAPFFSPLP VSETQQPQMS YTYSCSEVNN NGYSPPAYNT DSGKEIMTNN  240
NNVWGVHNRF LYNDNNGGGF NNQNESCHEM KSDSGVMGIQ SQLVNLQMAS NHQQQEEEDD  300
AHEYDEILKL W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-23321457120LOB family transfactor Ramosa2.1
5ly0_B3e-23321457120LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa06g021540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010515102.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS61e-155LBD27_ARATH; LOB domain-containing protein 27
TrEMBLR0HMD70.0R0HMD7_9BRAS; Uncharacterized protein
STRINGXP_010515102.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-140LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]