PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06709s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Dof
Protein Properties Length: 138aa    MW: 14884.7 Da    PI: 10.7608
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06709s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-391876361
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    +  lkcprCds+ntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvPvGgg+rkn+k+
  Csa06709s010.1 18 DGPLKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRKNNKK 76
                    56789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-33371IPR003851Zinc finger, Dof-type
PfamPF027011.9E-332075IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6372175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MGGSMAERAR QAKIPPPDGP LKCPRCDSSN TKFCYYNNYN LTQPRHFCKG CRRYWTQGGA  60
LRNVPVGGGC RKNNKKGKNG NSKSSSSSSK QSSTVNAPSP SSGQLRTNHQ FPFSPTLYNL  120
TQLGGIGLNL AATNGNNQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa06709s010.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1558160.0AF155816.1 Arabidopsis thaliana zinc finger protein OBP2 mRNA, complete cds.
GenBankAY0627150.0AY062715.1 Arabidopsis thaliana Strong similarity to zinc finger protein OBP2 (At1g07640; F24B9.30) mRNA, complete cds.
GenBankAY0933510.0AY093351.1 Arabidopsis thaliana strong similarity to zinc finger protein OBP2 (At1g07640) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF24B90.0AC007583.2 Arabidopsis thaliana chromosome 1 BAC F24B9 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010487779.12e-96PREDICTED: dof zinc finger protein DOF1.1-like isoform X3
RefseqXP_010497593.22e-96PREDICTED: dof zinc finger protein DOF1.1, partial
SwissprotQ8L9V64e-83DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLQ2V4Q11e-80Q2V4Q1_ARATH; Dof-type zinc finger DNA-binding family protein
STRINGXP_010487767.12e-95(Camelina sativa)
STRINGXP_010497593.11e-95(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-75Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]