PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g035690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 308aa    MW: 35347.1 Da    PI: 5.1202
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g035690.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF27.44.2e-091050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i nk  r+ tf +R++g  KK + L +LC+++v+ +i+ +
  Csa05g035690.1 10 FIPNKVIRKRTFNRRKEGFKKKLNDLKTLCNVDVCAVIYNP 50
                    799*********************************99965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.087149IPR002100Transcription factor, MADS-box
SMARTSM004325.9E-10160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-17177IPR002100Transcription factor, MADS-box
CDDcd002667.55E-21278No hitNo description
PfamPF003191.0E-111151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAKKKLNLTF IPNKVIRKRT FNRRKEGFKK KLNDLKTLCN VDVCAVIYNP FNSTPDAWPS  60
ESGVNSVIEK ALMVTEKKCE VLNHEKFLNQ YIEKVRKHED KLVEDNKEIR LKEAMFKCLG  120
GNMKDFQMND KDRSDLCEFL DGYLKDLYHH KKVNLNQPTF EIGESSSMQM ARTATTANMA  180
DADMAPTDVS PFMAPPSMAE VGFSSFLNAL FFNYPQPTNE FELIVSPNQT LGDMNFLSMT  240
LSNHGADHVD FQISDNNQEV YIPSVDQDEI HYPNQTYDGN QQGFIEEMIK YAEETNFPWI  300
VDNPNKF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa05g035690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010513274.10.0PREDICTED: LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL80
TrEMBLA0A178VYD31e-117A0A178VYD3_ARATH; AGL46
TrEMBLF4IIT61e-117F4IIT6_ARATH; AGAMOUS-like 46
TrEMBLQ7XJ971e-117Q7XJ97_ARATH; Uncharacterized protein
STRINGXP_010513274.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.11e-114AGAMOUS-like 46