PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g014650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family WRKY
Protein Properties Length: 513aa    MW: 56759.3 Da    PI: 7.6377
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g014650.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.2e-33177234260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  Csa05g014650.1 177 EDGYNWRKYGQKQVKGSENPRSYYKCTFQNCPTKKKVERSL-EGQITEIVYKGSHNHPK 234
                     7****************************************.***************85 PP

2WRKY105.72.4e-33356414159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d+++v++tYeg+Hnh+
  Csa05g014650.1 356 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDTRAVITTYEGKHNHD 414
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.2E-28165235IPR003657WRKY domain
SuperFamilySSF1182901.24E-24176235IPR003657WRKY domain
SMARTSM007741.9E-34176234IPR003657WRKY domain
PfamPF031063.4E-25177233IPR003657WRKY domain
PROSITE profilePS5081123.25177235IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.9E-37341416IPR003657WRKY domain
SuperFamilySSF1182902.09E-29348416IPR003657WRKY domain
PROSITE profilePS5081138.561351416IPR003657WRKY domain
SMARTSM007746.1E-39356415IPR003657WRKY domain
PfamPF031061.6E-25357414IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MAASSLLTMD NSRTRQNMNG SAANWSQQNG RTSLDDLEIP KFRSFAPSSI SISPSLVSPS  60
TCFSPSVFLD SPAFVSSSAN VLASPTTGAL ITNESNQTVI NEGEKKNNNN FNFFDFSFQT  120
QSSGVTAPKT TTTTTNSSIF QSQEQQRKNQ SDQWSQNETR QNNQAVSYNG REQRKGEDGY  180
NWRKYGQKQV KGSENPRSYY KCTFQNCPTK KKVERSLEGQ ITEIVYKGSH NHPKPQSTRR  240
SSSSSSTFHS AVYNASLDHH RQASSDQPNS NNNSSFHHSD SFPMQQEDNT TSDSVGDDEF  300
EQGSSIVSRD EEDCGSEPEA KRWKGENETN GGNGGVSKTV REPRIVVQTT SDIDILDDGY  360
RWRKYGQKVV KGNPNPRSYY KCTTVGCPVR KHVERASHDT RAVITTYEGK HNHDVPAARG  420
SGYATNRPSQ DASSVPIRPA AIAGHSNYTT SSQAPYTLQM LHNNNNNTNA GPFGYAMNNN  480
NLQTQQNFVG DGFSRAKEEP NEESSFFDSF MP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A7e-38177417878Probable WRKY transcription factor 4
1wj2_A7e-38177417878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0330300.0BT033030.1 Arabidopsis thaliana unknown protein (At2g38470) mRNA, complete cds.
GenBankAK2263010.0AK226301.1 Arabidopsis thaliana mRNA for putative WRKY-type DNA binding protein, complete cds, clone: RAFL05-11-J06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010509125.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLR0HAD40.0R0HAD4_9BRAS; Uncharacterized protein
STRINGAT2G38470.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33