PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g012080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 370aa    MW: 40964 Da    PI: 6.5129
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g012080.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10151208562
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Csa05g012080.1 151 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 208
                     9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-17147211IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622149212IPR004827Basic-leucine zipper domain
PfamPF001701.7E-9151209IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-10151202No hitNo description
Gene3DG3DSA:1.20.5.1705.2E-9151206No hitNo description
CDDcd147036.19E-22152201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MEDPSNPKSN QSNLPQCLPL TASAPTSAPF RGPYHRRAHS EVQFRLPEDL DLSEPFGGFD  60
ELGSEDDLFC SYMDIEKLGS GSGSASDSAG PSAPRSDNPF SAENGGAEAG NSRPRHRHSL  120
SVDGSSTLES IEAKKAMAPD KLAELWVVDP KRAKRIIANR QSAARSKERK ARYILELERK  180
VQTLQTEATT LSAQLSLFQR DTTGLSSENT ELKLRLQVME QQAKLRDALN DQLKKEVERL  240
KFATGEVSPA DAYNLGMAHM QYQHQPQQSY YQHHQQQTDA QNLQQMTHQF HLFQPNNNQN  300
QNTSSRQNPP TNHQLMHHAT SNAPAQSHSY SETMQEDPLG RLQGLDISSC GRGSNFGRSD  360
TVSESSSTM*
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa05g012080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010508829.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228730.0BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A178VZR10.0A0A178VZR1_ARATH; Uncharacterized protein
STRINGXP_010508829.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]