PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g009180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family VOZ
Protein Properties Length: 458aa    MW: 51378.1 Da    PI: 5.0221
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g009180.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ424.41.7e-1302264402216
             VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                     ppsaflgpkcalwdctrpa+gsew+ dycs+fhatlalne++pg tpvlrp+gi+lkd+ll++al+ak+qgk+vgip+cega+++k+pwnaaelf
  Csa05g009180.1 226 PPSAFLGPKCALWDCTRPAHGSEWYLDYCSNFHATLALNEDSPGATPVLRPGGISLKDNLLIDALRAKTQGKNVGIPVCEGAVNTKCPWNAAELF 320
                     7********************************************************************************************** PP

             VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvd 191
                     +l+l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++g+krsyymdpqps+sfewhl+ey+ine+da+alyrle k+ +
  Csa05g009180.1 321 HLELVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQEGQKRSYYMDPQPSGSFEWHLFEYQINESDACALYRLEKKVGN 415
                     *********************************************************************************************** PP

             VOZ 192 ekksakgkvskdsladlqkklgrlt 216
                     +kks+kgk+skd+ladlqkk+g+++
  Csa05g009180.1 416 GKKSPKGKISKDPLADLQKKMGQFK 440
                     **********************986 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MSNHPKMTCV SSAHQNLEEK LRELQEKFCH LQAARKEGRH GDLALLEAQI SQNLREWQAE  60
LTAPSPESSL LGEGISQFLE EFAEFAPLLK LDEEDDATST LKEHAAPKPE PEGFAQTLCP  120
PEWTSDHFSQ SLFNGNFSCG VEDAGNNTET HGQQLHYAFE GFDSSINTAP DFHDQKLSNL  180
DITSQYDYIC SEVRQELDNS PSIKLDSSEE IENFAEFTTP SSVRVPPSAF LGPKCALWDC  240
TRPAHGSEWY LDYCSNFHAT LALNEDSPGA TPVLRPGGIS LKDNLLIDAL RAKTQGKNVG  300
IPVCEGAVNT KCPWNAAELF HLELVEGETI REWLFFDKPR RAYDSGNRKQ RSLPDYSGRG  360
WHESRKQLMK EQEGQKRSYY MDPQPSGSFE WHLFEYQINE SDACALYRLE KKVGNGKKSP  420
KGKISKDPLA DLQKKMGQFK VASDKPSPQS NSRLLQQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBMTransfer from AT2G42400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa05g009180.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252570.0AB125257.1 Arabidopsis thaliana AtVOZ2 mRNA for Transcription factor AtVOZ2, complete cds.
GenBankAF3618310.0AF361831.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
GenBankAY0780480.0AY078048.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010508578.10.0PREDICTED: transcription factor VOZ2
RefseqXP_010508579.10.0PREDICTED: transcription factor VOZ2
RefseqXP_010508580.10.0PREDICTED: transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLR0FVW10.0R0FVW1_9BRAS; Uncharacterized protein
STRINGXP_010508578.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]