PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g058000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family VOZ
Protein Properties Length: 398aa    MW: 44730.4 Da    PI: 4.5518
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g058000.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ363.57.8e-1121973752180
             VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                     ppsaflgpkcalwdctrpa+gsew+ dycs++hatlalne++pg tpvlrp+gi+lkd+ll++al+ak+qgk+vgip+cega+++k+pwnaaelf
  Csa04g058000.1 197 PPSAFLGPKCALWDCTRPAHGSEWYLDYCSNYHATLALNEDSPGATPVLRPGGISLKDNLLIDALRAKTQGKNVGIPVCEGAVNTKCPWNAAELF 291
                     7********************************************************************************************** PP

             VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                     +l+l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++g+krsyymdpqp++sfewhl+ey+i+e+d+ 
  Csa04g058000.1 292 HLELVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQEGQKRSYYMDPQPPGSFEWHLFEYQISESDEK 375
                     *********************************************************************************985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSNHPKMTWR HGDLALLEAQ ISQNLREWQA ELTAPSPESS LLGEGISQYL EVFAEFAPLL  60
KLDEEDDATS TLKEHAAPKP EPEGFAQTLC PPEWTSDHFS QSPFNGNFSC GVEDAGNNTE  120
THGQQLHYAF EGFDSSINTA PDFHDQKLSN LDITSQYDYI CSEVRQELDN SPSIKLDSSE  180
EIENFAEFTT PSSVRVPPSA FLGPKCALWD CTRPAHGSEW YLDYCSNYHA TLALNEDSPG  240
ATPVLRPGGI SLKDNLLIDA LRAKTQGKNV GIPVCEGAVN TKCPWNAAEL FHLELVEGET  300
IREWLFFDKP RRAYDSGNRK QRSLPDYSGR GWHESRKQLM KEQEGQKRSY YMDPQPPGSF  360
EWHLFEYQIS ESDEKMGQFK VASDKPSPQS NSRLLQQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa04g058000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252570.0AB125257.1 Arabidopsis thaliana AtVOZ2 mRNA for Transcription factor AtVOZ2, complete cds.
GenBankAF3618310.0AF361831.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
GenBankAY0780480.0AY078048.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010517762.10.0PREDICTED: transcription factor VOZ2
RefseqXP_010517763.10.0PREDICTED: transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLR0FVW10.0R0FVW1_9BRAS; Uncharacterized protein
STRINGXP_010517761.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]