PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g049390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TALE
Protein Properties Length: 676aa    MW: 73776.5 Da    PI: 6.8524
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g049390.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094014381954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Csa04g049390.1 401 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 438
                     554459******************************88 PP

2BELL122.71.5e-39260331172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL ++l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  Csa04g049390.1 260 ERQEIQMKKAKLSNMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 331
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-82180329IPR006563POX domain
PfamPF075266.6E-47186328IPR006563POX domain
PROSITE profilePS5007112.26379442IPR001356Homeobox domain
SMARTSM003892.3E-9382446IPR001356Homeobox domain
CDDcd000862.31E-12382443No hitNo description
SuperFamilySSF466895.99E-17383449IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-29385448IPR009057Homeodomain-like
PfamPF059202.8E-18399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGSDGGL QTLILMNPTT YVQYTQQDDD SNNNNNNNSN NNNNTNTNNN  60
SFVFLDSHAP QPNASQQFVG IPLSGHEAAS ITAADNISVL HGYPPRVQYS LYGSHQVDPT  120
HQQAACETPR AQQGLSLTLS SQQQQQQQHH QQHQPIHVGF GSGPGEDIRV GSGSAGSGVT  180
NGIANLVSSK YLKAAQELLD EVVNADSDDI NAKSQLFSSK KGSSGNDKAV GESSTGAGGE  240
GSGGGGEAAG KRTVELGTAE RQEIQMKKAK LSNMLHEVEQ RYRQYHQQMQ MVISSFEQAA  300
GIGSAKSYTS LALKTISRQF RCLKEAIAGQ IKAANKSLGE EDSVSGVGRF EGSRLKFVDH  360
HLRQQRALQQ LGMIQHPTNN AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK DSDKHMLAKQ  420
TGLTRSQVSN WFINARVRLW KPMVEEMYTE EMKEQGKNMG SMEKNPLDQS NEDSASKSTS  480
NQEKSPMANT YHMNPNHNGD LEGVTGMQGS PKRLRTSEET MMQPINADFS SNEKLTMKIL  540
EERQGIRSDG GYPFMGNFGQ YQMDEMSRFD VVSDQELMAQ RYSGNNNGVS LTLGLPHCDS  600
LSSTHHQGFM QTHHGIPIGR RVKIGETEEY GTASINGGGS ATTAHSSAAA AAAYNGMNIQ  660
NQKRYVAQLL PDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16388446563Homeobox protein Meis2
3k2a_B2e-16388446563Homeobox protein Meis2
4xrs_A1e-16388445158Homeobox protein Meis1
4xrs_B1e-16388445158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa04g049390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2272720.0AK227272.1 Arabidopsis thaliana mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL11-09-C20.
GenBankAY0721750.0AY072175.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0965480.0AY096548.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0998540.0AY099854.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankBT0084220.0BT008422.1 Arabidopsis thaliana At2g35940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505121.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLR0HRR20.0R0HRR2_9BRAS; Uncharacterized protein
STRINGXP_010505121.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]