PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g030860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LBD
Protein Properties Length: 335aa    MW: 37572.4 Da    PI: 4.483
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g030860.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31.1e-37101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e +r++am+s+++++ +r r Pv+G++gv ++lq  +  +++el+
  Csa04g030860.1  10 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILERLDEIQRPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWLAEEELK 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  Csa04g030860.1 105 AVNSQL 110
                     999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.029110IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTLKGGTSGA CAACKYQRRR CAADCPLAPY FPAEQPKLFQ NVHRLFGVRS IVKILERLDE  60
IQRPEAMKSI IFQSYVRDRS PVHGCLGVTQ QLQYMIWLAE EELKAVNSQL QLYRSQNDGQ  120
NQQNHNQIMI NDLGVGVDNK QQQDDVTSQL DLGMGLNVNN NQSNVVAPFF SPLPVSETQQ  180
PQMSYTYSCS EVNNNGYSPP AYNTDSGKEI MTNNNNVWGV HNRFMYNDNN GGGFNNQNES  240
CHEMKSDSGV MGIQSQLVNL QMASNHQQQE EEDDAHEYDE IHQFLEIIDD RQSFADSKEA  300
YASSSGETLK EQIDEIGENE LRSAATCFSL TSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2461197120LOB family transfactor Ramosa2.1
5ly0_B3e-2461197120LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa04g030860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738620.0AB473862.1 Arabidopsis thaliana ASL29 mRNA for ASYMMETRIC LEAVES2-like 29 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010507287.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS61e-164LBD27_ARATH; LOB domain-containing protein 27
TrEMBLR0HMD70.0R0HMD7_9BRAS; Uncharacterized protein
STRINGXP_010507287.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-154LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]