PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g060290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SBP
Protein Properties Length: 178aa    MW: 20349.6 Da    PI: 9.8636
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g060290.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.32e-4263138277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv++C++dl+eak+yhrrhkvCevh+ka++v++sg++qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
  Csa03g060290.1  63 CQVDRCTSDLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSS 138
                     **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.7E-601149IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.102.3E-3357124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.26560137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3862141IPR004333Transcription factor, SBP-box
PfamPF031103.7E-3263136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MEGRRTQGKG YLKSKSYLVE EEMENDMDGE EEVGRDEERR KGLMDGVRRS SGSIDRGGSS  60
RLCQVDRCTS DLKEAKQYHR RHKVCEVHAK ASSVFLSGVS QRFCQQCSRF HELQEFDEAK  120
RSCRRRLAGH NERRRKSSGE SFGEGSGRTG ITGQVIQNQE RSRVEMPNSS FKRPQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-4661136984squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010500948.11e-125PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ9S7A96e-87SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLD7KKE31e-101D7KKE3_ARALL; Squamosa promoter-binding-like protein
STRINGfgenesh2_kg.1__4389__AT1G53160.21e-100(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.25e-61squamosa promoter binding protein-like 4