PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g036590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family G2-like
Protein Properties Length: 395aa    MW: 44430.2 Da    PI: 8.2469
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g036590.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32220273255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Csa03g036590.1 220 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 273
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15217273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28218273IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23220273IPR006447Myb domain, plants
PfamPF002492.6E-7221272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSTLVSNS  60
SSKPTNHPFQ DLSLSNNSHQ QQQKQHQHHQ PHLVPNCNGS NILTSFQFPT QQQQQHLQGF  120
LAHDLNTHLR PIRGIPLYHN PPPHHHHRPP PPCFPFDPSS LIPSSSPSPP SLTGNNNTSS  180
VSNSGLITNP NYHNHHHHHQ TLNRARFMPR FPAKRSMRAP RMRWTTTLHA RFVHAVELLG  240
GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTDKA AASSGQSDVY ENGSSGDNNS  300
DDWMFDMNRK SRDSEEVTNP LEKGNGLWTN SSGEARLHGK LIDNVAEIML PSEKEIDGKC  360
SSYERISSEE MSSSSISGTS PFKPNLEFTL GRSH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010499772.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR210.0A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGAT1G32240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-177G2-like family protein