PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g024450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Nin-like
Protein Properties Length: 853aa    MW: 94774.4 Da    PI: 5.3859
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g024450.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85e-29562612252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Csa03g024450.1 562 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 612
                     689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2551632IPR003035RWP-RK domain
PfamPF020423.3E-25564612IPR003035RWP-RK domain
SuperFamilySSF542778.83E-23743840No hitNo description
SMARTSM006661.7E-26752835IPR000270PB1 domain
PROSITE profilePS5174528.83752835IPR000270PB1 domain
CDDcd064072.38E-43753833No hitNo description
Gene3DG3DSA:3.10.20.2403.7E-21753832No hitNo description
PfamPF005641.1E-19753834IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MEDSFLQTEN AVMDSEFMDG LLLDGCWLET TDGSEFLNVA SSTSSVSPFD PSSFMWSPTQ  60
DASAALCTSG GVVSQMYGQD CVERSSLDDF QWNKRWWIGP GGGGGSSVTE RLVQAVEHIK  120
DYTTERGSLI QLWVPVNRGG KRVLTTKEQP FSHDPMCQRL ANYREISVNY HFSAEQDDSK  180
ALAGLPGRVF LGKLPEWTPD VRFFKSEEYP RVHHAQDCDV RGTLAIPVFE QGSKICLGVI  240
EVVMTTEMVK LRPELESICK ALQAVDLRST ELPISPSLKG CDLSYKAALP EIRKLLRCAC  300
ETHKLPLAQT WVSCLQQNKS GCRHNDENYI HCVSTIDDAC YVGDPTVREF HEACSEHHLL  360
KGQGVAGQAF LTNGPCFSSD VSNYKKSEYP LSHHANMYGL HGAVAIRLRC IHTGSADFVL  420
EFFLPKDCDD LEEQRKMLNA LSTIMAHVPR SLRTVTDKEL EEESEVIERE EIVTPKIENT  480
SELQQLHGNS PWSASLEEIQ RSNNTSNPQN LGLVFDGGDK PNDGFGLKRG FDYTMDSNVN  540
ESSSFSSGGF SMTAEKKRTK ADKTITLDVL RQYFAGSLKD AAKNIGVCPT TLKRICRQHG  600
IQRWPSRKIK KVGHSLQKIQ RVIDSVQGVS GPLPIGSFYA NFPNLVSQSQ EPSQQAKTSP  660
PSAPPPPVQL AKSPVSSYSQ SSNSSQCCSS ETQLNSGATT DPASASVGVS LKKTGSEIEL  720
QSSSLDETIL TLSSLENVPQ GTNLLSSQDD DFLRIKVSYG EEKIRFRMRN SRRLTDLLWE  780
IGKRFSIDDM SRYDLKYLDE DNEWVLLTCD EDVEECVDVC RTTPSHTIKL LLQVSSHHFP  840
ERSSATEYSL WH*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa03g024450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010498499.10.0PREDICTED: protein NLP4-like isoform X1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGXP_010498499.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein