PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g023300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 468aa    MW: 52024 Da    PI: 5.3433
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g023300.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.32.9e-07153213161
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++
  Csa03g023300.1 153 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLET 213
                     78899*****************************************998888888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-9153217IPR004827Basic-leucine zipper domain
PfamPF001706.8E-7153215IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.036155218IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-6157222No hitNo description
SuperFamilySSF579593.04E-6157212No hitNo description
CDDcd147021.09E-12163209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MELEPISSCC SSSGEEAAAA DMTEMEAAEA LADLAQLAIM REQVFEPASS WGSKGKRVRK  60
RAKTESPPSD SLLKPPDSET LPTPDLAEER LVKEEEDEEE EEDEVQPITK ELTKAPVKTE  120
MNGETPKPNL ASTIRCTRSN GCGRSRQNLS EAEREERRIR RILANRESAR QTIRRRQAMC  180
EELSKKAADL TYENENLRRE KDWALKEFQS LETMNKHLKE QVAKSVKPDT KEPEEPPKPS  240
KVEMSTSSTP IYFYNQNPYQ LFCWPHVTQS ANPTISPLEF ATSGGASAKA MTPQEHENPA  300
DGNGQKTHFY VVPCPWFLPP PDSNGVSFGV QDTQKGTLSN GHHLDDSSAR PLEVTKTPWS  360
HLPTRIKEED SGSPETRPLY DLNESATEVL SEGGEGFPVT QQAFSFKHED ISETTNGVTP  420
VPPGHHVLIS LPGKNQGSLA AAEARKRRKE LTRLKNLHGR QCRMQVG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444449RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa03g023300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010498367.10.0PREDICTED: uncharacterized protein LOC104776061
TrEMBLR0II410.0R0II41_9BRAS; Uncharacterized protein
STRINGXP_010498367.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein