PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g015150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GeBP
Protein Properties Length: 385aa    MW: 42461.2 Da    PI: 5.1273
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g015150.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573130.75.6e-41155250297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+w+e+Dei++LqGl+d+k++tg+sp+dd++++y+ vkks+sf+vsk q++eK+r+LKkK++++v kak+g+epsf+k+ d+k+fe+sk +W
  Csa03g015150.1 155 YFQRVWTEDDEIAVLQGLMDYKKDTGVSPYDDTNGVYQLVKKSVSFDVSKIQFMEKLRSLKKKYENNVGKAKNGEEPSFAKPYDRKTFEFSKLVW 249
                     79********************************************************************************************* PP

          DUF573  97 g 97 
                     g
  Csa03g015150.1 250 G 250
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-32156250IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSSKRFNPLE DPPSASSSDD DEVDAPLEEG DEIVGNSSSD EEEYDDDLPS EPPMKNVLFH  60
PATTDKLVSD SESGSGEETE SDTEPRKKKD QFLTVKHVTE TKDSVAKDQD SKKVKTSEKS  120
VGKRSRQTVD EGVVSSTKRV KKSVGGGGEE TKKTYFQRVW TEDDEIAVLQ GLMDYKKDTG  180
VSPYDDTNGV YQLVKKSVSF DVSKIQFMEK LRSLKKKYEN NVGKAKNGEE PSFAKPYDRK  240
TFEFSKLVWG ANGMALDSVV KPNGKSKKSS KSKKVESVKQ EIDSSLPNGK NSEDEVTNKG  300
GVSLLGVADM DVFAKSSLVK SLARVGVDEL AADRGLSLLT SEDKKRIEEQ WKALQVRELE  360
FHSQKSGFIH DVVTKIGEAF RSNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492929.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLR0I1M21e-154R0I1M2_9BRAS; Uncharacterized protein
STRINGAT1G11510.11e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.16e-82DNA-binding storekeeper protein-related transcriptional regulator