PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g071880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family Dof
Protein Properties Length: 164aa    MW: 18383.6 Da    PI: 9.7155
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g071880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.79.3e-373897362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++ +kcprC+st+tkfCyynnyslsqP yfCk+Cr yWtkGG+lrn+PvGgg+rknkk s
  Csa02g071880.1 38 DHPQKCPRCESTHTKFCYYNNYSLSQPLYFCKTCRYYWTKGGTLRNIPVGGGCRKNKKPS 97
                    6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273391IPR003851Zinc finger, Dof-type
PfamPF027015.7E-313995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.1774195IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MLGSSVIRRK HVRLFEDFSI SSRHTGCWQH YSLSQPHDHP QKCPRCESTH TKFCYYNNYS  60
LSQPLYFCKT CRYYWTKGGT LRNIPVGGGC RKNKKPSSSN SSSSTSFGKK PSDIVTTNTT  120
DLMALAHSHQ NYQNSPLGFS HFGGIMGSYS TPEHSNVGFL ESK*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa02g071880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0090531e-156AB009053.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQB2.
GenBankAK2289921e-156AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBankBT0204671e-156BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205761e-156BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankCP0026881e-156CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866523.11e-69dof zinc finger protein DOF5.6
SwissprotQ9FM036e-68DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLD7MNC93e-68D7MNC9_ARALL; Uncharacterized protein
STRINGXP_010478252.11e-119(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.19e-69Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]