PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g044350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 566aa    MW: 60826.3 Da    PI: 8.1584
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g044350.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.19.7e-15118157141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e
  Csa01g044350.1 118 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVE 157
                     589**************************.********975 PP

2TCR49.96.3e-16204242240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     + kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Csa01g044350.1 204 HYKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 242
                     789**********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-16118158IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.427119243IPR005172CRC domain
PfamPF036387.0E-11120155IPR005172CRC domain
SMARTSM011147.1E-19203244IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12206241IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MGEGEGEGDK LPPKKDEVIT QDSMKSARQL DFTHVVHPPH SNQAPVTSIP SPAVTATPPI  60
TTSQARPVST TTVATPIPPP PQPQGLLHVP IRHPERFESP NSKPRPVGVG ETRDGTPQKK  120
KQCNCKHSRC LKLYCECFAS GTYCDGCNCV NCFNNVEFDT ARREAVQTIL DRNPNAFKPK  180
IASSPHGGRD SREEVGEPVM LGKHYKGCHC KKSGCLKKYC ECFQANILCS ENCKCLDCKN  240
FEGSEDRQSL FHGEHSHNVA YLQHVNAAIT GAIGSYGFAS APGPKRKKGQ EFFYNQGTKD  300
SPTHRLGQAN TGRTPSSETD SRAGGPSKVV YRSLLADIIQ PKNVKALCSV LVAVAGEAAK  360
ALTEKRLADQ KETSVSSSVQ DQGQGNNKGT EIEIAATGNQ AEKSGPEDSS SDGSKGRSLS  420
PDTLALMCDE RDTMLMVAAS PKGSVEPTSQ LPNGGQDQFY AEQEKVVLTK FRDCLNQIIS  480
CGELKESNFS SSRMNLDTPA HTAVKVQPVV QQRPVANGVS QTIKQPSQLT TTTPTPTPTA  540
TTTTPTTSAQ TQLHKTPALS EKKDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-351102521132Protein lin-54 homolog
5fd3_B3e-351102521132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa01g044350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
GenBankAY1637750.0AY163775.1 Arabidopsis thaliana hypothetical protein (T2G17.9) mRNA, partial cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416287.10.0PREDICTED: protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A1P8B2C50.0A0A1P8B2C5_ARATH; Tesmin/TSO1-like CXC domain-containing protein
STRINGXP_010416280.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein