PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g035170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family M-type_MADS
Protein Properties Length: 301aa    MW: 35085.7 Da    PI: 8.9585
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g035170.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.56.3e-121151343
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    +en+  r+  + k r g++KK +EL +LCd+ +++i+fs++
  Csa01g035170.1 11 VENEKSREEKLKKKRVGLMKKVKELMILCDVMACIIMFSPK 51
                    6899999999*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-13160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.647151IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-5323IPR002100Transcription factor, MADS-box
CDDcd002662.24E-21485No hitNo description
SuperFamilySSF554551.83E-17493IPR002100Transcription factor, MADS-box
PfamPF003191.5E-111151IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAIKKLKLAW VENEKSREEK LKKKRVGLMK KVKELMILCD VMACIIMFSP KEVEPMVWPS  60
VEKAHGLLEI FFSLPEIKNK KKEMNLESYL KEKKEKVHEQ FLKSNKKHMG YVIDQLMVQL  120
HRGRRIDDLD LSEIFALISF SRDDIILRRK ELKFVQYSPL RYPPILPFEA HFKEPRNTRY  180
DERSWKTDEE TKIISIDPLT PKPRNDQEIR MGMISHNKNH DHVLYQGNNS NENPDLDIAP  240
VGSPMLTFHG FDGPISQQLK DHAMLDNPTM SMRQPRQHLS DFMSHEFGVN GGSTVSIDDS  300
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa01g035170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019087925.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLV4NQI01e-96V4NQI0_EUTSA; Uncharacterized protein
STRINGBostr.18351s0040.1.p1e-141(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-75AGAMOUS-like 48