PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa01g026040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CPP
Protein Properties Length: 1217aa    MW: 132639 Da    PI: 6.411
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa01g026040.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.68.1e-16309347240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Csa01g026040.1 309 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 347
                     689**********************************96 PP

2TCR50.15.3e-16394432139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Csa01g026040.1 394 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 432
                     589***********************************7 PP

3TCR49.58.4e-16920958240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Csa01g026040.1 920 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 958
                     689**********************************96 PP

4TCR50.34.8e-1610051043139
             TCR    1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39  
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Csa01g026040.1 1005 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNV 1043
                      589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19308349IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.223309434IPR005172CRC domain
PfamPF036381.3E-11311346IPR005172CRC domain
SMARTSM011143.7E-17394435IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.1E-11396432IPR005172CRC domain
SMARTSM011142.4E-19919960IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.5789201045IPR005172CRC domain
PfamPF036381.3E-11922957IPR005172CRC domain
SMARTSM011141.9E-1710051046IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-1110071042IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1217 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPVSKLKS EDSPVFNYIC NLSPIKTLKS IPIAQTLSSL NFTSPPSVFS  60
SPHAVSHKES RFRSQINKDV AASVGEEVEE EALIGNEPSQ NVKNDFSTPK VSNDVRGGGN  120
GSCEDGGMDL LKICDNVKKK SDTPDWETLI AATTELIYGS PSESEAFSCL LKRRSNSGAR  180
VRGGGGTMST SAPVSSTVVG NNETESFDAN SILHRGVRRR CLDFEVPGNN QQTLGESSSS  240
CVVPSIGLHL NAIAMSSKEN NNVPNEYSLS GNVKVGLQSS TSPVLHSQQD AVQAVEERKS  300
EQSGEGESSC KRCNCKKSKC LKLYCECFAA GVYCIEPCSC IDCFNKPIHE DVVLATRKQI  360
ESRNPLAFAP KVIRNSDSII EVGDDTSKTP ASARHKRGCN CKKSNCLKKY CECYQGGVGC  420
SINCRCEGCK NAFGRKDGSL FEQDEENEVS GKRVTAKTQQ NAELFNPVAP PSTPIPYRQP  480
LSQLAISSNN RLLPPVSHFH HGASGSSSSG IYNIRKPDMS MVSHSRIETI TEDIDDDDDM  540
PENLLNHSPM TNMKAVDSPV FNYISNLSPI ESVKSISTAQ TFSSLSFTSP PPVFTSPHVS  600
SHRESRFFRC HNSIDRTKPL EDLNGSVCKE EVEVPVIEDL NKEAPLEDEE EETSVETSSE  660
LPQILKSDSQ TPDRSDSPCT DDVTVEAPSD IPLGEGGSSS DDVKMGLQKM LDVREANDTP  720
NCGRLISDAT ELLVFRSPND SEAFRCLVDK ISSSERRFCA GVKSTKRPDI NKAVPVNGSS  780
NENEPLAVLP NESVFSLHRG GMRRRCLDFE MPGKRKKEIA DDQQSVCDNK AAGESSSRCV  840
VPSIGLHLNA VALSARDSNI NVVHDYSISG EIQKSFSGST TPIHSQDTVQ ETSDQAENEP  900
VEEVPRALVR VSEPAGEGES CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CIDCFNKPVH  960
EETVLATRKQ IESRNPLAFA PKVIRSADSI MEAGDDASKT PASARHKRGC NCKKSNCLKK  1020
YCECYQGGVG CSINCRCEGC KNVFGRKEGA LLAIMESKQE EDQETYEKRR AKIQHKIEGS  1080
SEVEQNPSSD QPSTPLPPYR HLVVHQPFLS KNRLPPTQFF IGMGSSSFRK QDSDLTQSHN  1140
GKKPVDPVTE DKTEIMPEIL LNSPIANNKA ISPNSKRVSP PQLGSSESGS NLRRRGNGRK  1200
LILRSIPAFP SLNPNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-16311104312121Protein lin-54 homolog
5fd3_B2e-16311104312121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1802816RRRCLDFEMPGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa01g026040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040590.0AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063240.0AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
GenBankAY0460190.0AY046019.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
GenBankAY1426420.0AY142642.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010511676.10.0PREDICTED: CRC domain-containing protein TSO1-like
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLM4CCF40.0M4CCF4_BRARP; Uncharacterized protein
STRINGBra001884.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]