PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574748.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family CPP
Protein Properties Length: 520aa    MW: 56842.8 Da    PI: 6.6206
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574748.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.29.3e-152664241
             TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                    ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ +
  XP_012574748.1 26 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVD 64
                    89**************************.********986 PP

2TCR51.12.6e-16110149140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  XP_012574748.1 110 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 149
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-172565IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.7426150IPR005172CRC domain
PfamPF036382.5E-112762IPR005172CRC domain
SMARTSM011148.4E-20110151IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.7E-13113148IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MVLSGLESPK PRSRPNFDMK EGTPKKQKQC NCKHSKCLKL YCECFASGIY CDGCNCVNCF  60
NNVDNEAARR EAVEATLERN PNAFRPKIAS SPQGTRASSE EAGEGVILVK HNKGCHCKKS  120
GCLKKYCECF QANILCSENC KCMDCKNFEG SEERQALFHV DQNQNQNQNN HTYIQQAANA  180
AITGAIGSYG FSSPPVSKKR KGQELFLWPT AKDPSISKSG QQVNHVKAPA PSSALSPASS  240
ARVGNATLGH SPSKLKYRSL LADVIQPHHL KELCSVLVLV SGQAAKTRAD QKNLMEKHTE  300
DQTETSLASS TEGQLPTQKE VDVEKAMADD CSSANQIDKI SPGNSCSDGA DVPKGRPMSP  360
GTLALMCDEQ DTMFMTAASP IGPTTRVCNT SSQFPCGQGV TEVYAEQERA VLTQFRDFLN  420
RVITMGEINE TKCSSLARSE LENQKDPINN EIGNASTDIV HQQEATNNGD TKNIDPSMPT  480
TSTPVIPNDI VAENGEKINL KMEKEILKDS YLEEYEERHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-31181602133Protein lin-54 homolog
5fd3_B6e-31181602133Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012574748.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-131AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574748.10.0protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD11e-178TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A1S3EH530.0A0A1S3EH53_CICAR; protein tesmin/TSO1-like CXC 5 isoform X2
STRINGAES768180.0(Medicago truncatula)
STRINGAES768960.0(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-157Tesmin/TSO1-like CXC domain-containing protein