PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574747.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family CPP
Protein Properties Length: 604aa    MW: 65694.9 Da    PI: 6.8307
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574747.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.91.1e-14110148241
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ +
  XP_012574747.1 110 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVD 148
                     89**************************.********986 PP

2TCR50.93.2e-16194233140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  XP_012574747.1 194 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 233
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-17109149IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.74110234IPR005172CRC domain
PfamPF036383.0E-11111146IPR005172CRC domain
SMARTSM011148.4E-20194235IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12197232IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAEGEGGDCG MKNVPSPAAL EFVVSASPTA ATTAWLDAPA KKLARQLDFN AMMEQSKPQL  60
QTPSLMLQKQ VSGSPLPHQT LHGSVRVGKP ESPKPRSRPN FDMKEGTPKK QKQCNCKHSK  120
CLKLYCECFA SGIYCDGCNC VNCFNNVDNE AARREAVEAT LERNPNAFRP KIASSPQGTR  180
ASSEEAGEGV ILVKHNKGCH CKKSGCLKKY CECFQANILC SENCKCMDCK NFEGSEERQA  240
LFHVDQNQNQ NQNNHTYIQQ AANAAITGAI GSYGFSSPPV SKKRKGQELF LWPTAKDPSI  300
SKSGQQVNHV KAPAPSSALS PASSARVGNA TLGHSPSKLK YRSLLADVIQ PHHLKELCSV  360
LVLVSGQAAK TRADQKNLME KHTEDQTETS LASSTEGQLP TQKEVDVEKA MADDCSSANQ  420
IDKISPGNSC SDGADVPKGR PMSPGTLALM CDEQDTMFMT AASPIGPTTR VCNTSSQFPC  480
GQGVTEVYAE QERAVLTQFR DFLNRVITMG EINETKCSSL ARSELENQKD PINNEIGNAS  540
TDIVHQQEAT NNGDTKNIDP SMPTTSTPVI PNDIVAENGE KINLKMEKEI LKDSYLEEYE  600
ERHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-301022442133Protein lin-54 homolog
5fd3_B1e-301022442133Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012574747.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-130AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574747.10.0protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A1S3EFY40.0A0A1S3EFY4_CICAR; protein tesmin/TSO1-like CXC 5 isoform X1
STRINGAES768180.0(Medicago truncatula)
STRINGAES768960.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-161Tesmin/TSO1-like CXC domain-containing protein