PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family BES1
Protein Properties Length: 316aa    MW: 34476.7 Da    PI: 9.5709
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574557.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822198.91.6e-6151261122
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     g+sgr ptwkErEnnkrRERrRRaiaakiy+GLR+qGn+klpk++DnneVlkALc+eAGw+ve+DGttyrkgsk++  +e++g+  ++s +ss+q
  XP_012574557.1   5 GSSGRLPTWKERENNKRRERRRRAIAAKIYSGLRSQGNFKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGSKRPLPNEIGGTPPNMSACSSMQ 99 
                     689*************************************************************************9****************** PP

          DUF822  96 sslkssalaspvesysaspksssfpsp 122
                      s++ss+++spv+sy+asp+  +   +
  XP_012574557.1 100 PSPQSSSFPSPVPSYHASPTRMDGITN 126
                     ******************987665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.2E-576120IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTGGGSSGRL PTWKERENNK RRERRRRAIA AKIYSGLRSQ GNFKLPKHCD NNEVLKALCA  60
EAGWIVEEDG TTYRKGSKRP LPNEIGGTPP NMSACSSMQP SPQSSSFPSP VPSYHASPTR  120
MDGITNSSSF LLPFIRNITS IPTNLPPLRI SNSAPVTPPL SSPRSSKRKA DFESLSNGSL  180
NSSFRHPLFA TSAPSSPSRR NHLPPCSIPE CDESDASTVD SDRWVSFQTT GAQGAAPPSP  240
TFNLMKPVMQ KITPQGSMDM IHMNEGMQWA SSSAAERGRG SDFDFENGRV VKPWEGERIH  300
EVGMDELELT LGFGKA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9621210.0CR962121.2 Medicago truncatula chromosome 5 clone mte1-77f5, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574557.10.0PREDICTED: BES1/BZR1 homolog protein 2
SwissprotQ94A431e-101BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLG7KC601e-178G7KC60_MEDTR; Brassinazole-resistant 1 protein
STRINGPOPTR_0005s12790.11e-141(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.29e-76BES1 family protein