PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574211.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 808aa    MW: 89088.2 Da    PI: 6.1868
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574211.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.5e-21118173156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  XP_012574211.1 118 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 173
                     688999***********************************************999 PP

2START210.27.6e-663205441206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+a+ +ep+W +s     e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + +t+
  XP_012574211.1 320 ELALAAMDELVKMAQTSEPLWIRSIeggrEILNHEEYMRTFTPCIGlrpngFVSEASRETGMVIINSLALVETLMDSN-RWIEMFPciiaRTSTT 413
                     5899**************************************9999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     evis+g      galqlm+ael +lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++++  +s+v +++lpSg+++++++ng+skvtwveh+
  XP_012574211.1 414 EVISNGingtrnGALQLMQAELHVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRENSGAPSFVNCRKLPSGCVVQDMPNGYSKVTWVEHA 508
                     **************************************************************9******************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++h+l+r+l++sg+ +ga +wv tlqrqce+
  XP_012574211.1 509 EYEENQVHQLYRPLLSSGMGFGATRWVVTLQRQCEC 544
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-20103175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-22107175IPR009057Homeodomain-like
PROSITE profilePS5007117.216115175IPR001356Homeobox domain
SMARTSM003899.9E-18116179IPR001356Homeobox domain
CDDcd000863.93E-18117175No hitNo description
PfamPF000461.4E-18118173IPR001356Homeobox domain
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PROSITE profilePS5084844.721311547IPR002913START domain
SuperFamilySSF559611.65E-34313544No hitNo description
CDDcd088755.91E-127315543No hitNo description
PfamPF018522.1E-57320544IPR002913START domain
SMARTSM002341.8E-48320544IPR002913START domain
SuperFamilySSF559612.2E-23572801No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MSFGGFVENN SGGGSVRNIA AEISYNNNQR MSFGSISHPR LVTTPTLAKS MFNSPGLSLA  60
LQQTNIDGQE DVNRSMHENF EQNGLRRSRE EEQSRSGSDN LDGVSGDEQD ADDKPPRKKR  120
YHRHTPQQIQ ELEALFKECP HPDEKQRLEL SKRLCLETRQ VKFWFQNRRT QMKTQLERHE  180
NSLLRQENDK LRAENMSIRD AMRNPICSNC GGPAMIGEIS LEEQHLRIEN ARLKDELDRV  240
CALAGKFLGR PISTLPNSSL ELGVGGNNGF NGMNNVSSTL PDFGVGMSNN PLAIVSPSTR  300
QTTPLVTGFD RSVERSMFLE LALAAMDELV KMAQTSEPLW IRSIEGGREI LNHEEYMRTF  360
TPCIGLRPNG FVSEASRETG MVIINSLALV ETLMDSNRWI EMFPCIIART STTEVISNGI  420
NGTRNGALQL MQAELHVLSP LVPVREVNFL RFCKQHAEGV WAVVDVSIDS IRENSGAPSF  480
VNCRKLPSGC VVQDMPNGYS KVTWVEHAEY EENQVHQLYR PLLSSGMGFG ATRWVVTLQR  540
QCECLAILMS SAAPSRDHSA ITAGGRRSML KLAQRMTNNF CAGVCASTVH KWNKLSPGNV  600
DEDVRVMTRK XXXDPGEPPG IVLSAATSVW LPVSPQRLFD FLRDERLRSE WDILSNGGPM  660
QEMAHIAKGQ DHGNCVSLLR ASAMNSNQSS MLILQETCID EAGSLVVYAP VDIPAMHVVM  720
NGGDSAYVAL LPSGFAVVPD GPGSRGPENE TTTNGGETRV SGSLLTVAFQ ILVNSLPTAK  780
LTVESVETVN NLISCTVQKI KAALQCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012574211.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574211.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3EGX50.0A0A1S3EGX5_CICAR; homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
STRINGXP_004510857.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]