PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574062.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GRAS
Protein Properties Length: 554aa    MW: 61554.4 Da    PI: 6.1648
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574062.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS250.47.1e-771695482374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL  cA a++ g+l+++q+lL  l+elas +gd+++Rlaa+ ++AL ++l++s+s++++   + +++  +     ++l  f+evsP++ f + 
  XP_012574062.1 169 EQLLNPCAAAIAGGNLNRVQHLLYVLHELASTTGDANHRLAAHGLRALTHHLSSSSSSTSSGAITFAST--EPRFFQKSLLKFYEVSPWFSFPNN 261
                     689***************************************************888888877666665..34555556666************* PP

            GRAS  97 taNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg...........skeeleetgerLakfAeelgvp 175
                     +aN  Il+ +++e    +++Hi+D+++s+G+QWp++l+aL+ Rp ++pp +R+T+v +++s                  +   rL  +A++++v+
  XP_012574062.1 262 IANASILQVLAEEpnnsRTIHILDIGVSHGVQWPTFLEALSRRPgGPPPLVRLTVVTASSSAendqnmetpfsIGPCGDNFSTRLLGYAQSINVN 356
                     **********999888899*************************55566*******998877777666655544445567889************ PP

            GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyysal 267
                     +++n l  + l++l+ +  +++p+E+ +V+ +++lh+l    +++++er+e+Lk++++++Pk v+++e+++++   + ++F+++f++ +ey + +
  XP_012574062.1 357 LQINKLDNHPLQTLNAKIVDTSPDETFIVCAQFRLHHLN---HHTPDERSEFLKVLRDMEPKGVILSENNLECccsSCGDFATGFSRRVEYLWRF 448
                     *****9999*****************************9...55555566********************7775334569*************** PP

            GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                     +ds+++ +    + r + Er++++ e+ ++++++ ++    +e  ekW er++eaGF    ++e+a +  ++llrk++ +++++vee++ s+ + 
  XP_012574062.1 449 LDSTSSAF----KGRENDERRMMEGEAAKALTNQREM----NEGREKWCERMKEAGFAGEIFGEDAIDGGRALLRKYDsNWEMKVEEKNTSVGIW 535
                     ****6664....4444455555555678888777766....99999********************************9999************* PP

            GRAS 362 WkdrpLvsvSaWr 374
                     Wk++p+ ++S W+
  XP_012574062.1 536 WKGQPVSFCSLWK 548
                     ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.331142527IPR005202Transcription factor GRAS
PfamPF035142.5E-74169548IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MTMEPNPTSD HILDWLEGSV SFFPSFLDDP YNNGYIQEYQ LWDQNQEISN QCQTDTNTDS  60
TNATNSTTNI VAASTTTSTT SLEPNSSNNI PFSDLPKKRN ATDESSLKKQ SQNQKNKRIK  120
SRSMNEADNG DAALEGTVVR KPGGNKKSAA KANGSNCNSG NNKDGRWAEQ LLNPCAAAIA  180
GGNLNRVQHL LYVLHELAST TGDANHRLAA HGLRALTHHL SSSSSSTSSG AITFASTEPR  240
FFQKSLLKFY EVSPWFSFPN NIANASILQV LAEEPNNSRT IHILDIGVSH GVQWPTFLEA  300
LSRRPGGPPP LVRLTVVTAS SSAENDQNME TPFSIGPCGD NFSTRLLGYA QSINVNLQIN  360
KLDNHPLQTL NAKIVDTSPD ETFIVCAQFR LHHLNHHTPD ERSEFLKVLR DMEPKGVILS  420
ENNLECCCSS CGDFATGFSR RVEYLWRFLD STSSAFKGRE NDERRMMEGE AAKALTNQRE  480
MNEGREKWCE RMKEAGFAGE IFGEDAIDGG RALLRKYDSN WEMKVEEKNT SVGIWWKGQP  540
VSFCSLWKLN KQLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-4016454883473Protein SHORT-ROOT
5b3h_B1e-4016454829419Protein SHORT-ROOT
5b3h_E1e-4016454829419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012574062.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2296920.0AC229692.10 Medicago truncatula clone mth2-60b17, complete sequence.
GenBankAJ9724730.0AJ972473.1 Medicago truncatula partial NSP1 gene for Nodulation Signaling Pathway 1 protein.
GenBankAJ9724780.0AJ972478.1 Medicago truncatula NSP1 gene for Nodulation Signaling Pathway 1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574062.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A1S3EDZ30.0A0A1S3EDZ3_CICAR; nodulation-signaling pathway 1 protein
STRINGAET017700.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-147GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]