PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012573579.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family bZIP
Protein Properties Length: 213aa    MW: 24310.8 Da    PI: 6.9162
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012573579.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.71.4e-14104163463
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     +++ +r+ +NRe+ArrsR+RKk++ie L+  v+ L++ N++L +++  l +  ++  +++
  XP_012573579.1 104 DRKKKRMFSNRESARRSRLRKKQQIEVLQYHVDHLQSLNHQLSQKVIYLLECNQQIHQQN 163
                     7899**************************************999766655555555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-13101165IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.231103166IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11105156No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-12105162No hitNo description
PfamPF001703.4E-12105163IPR004827Basic-leucine zipper domain
CDDcd147025.01E-13106154No hitNo description
PROSITE patternPS000360108123IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MECNDDEHHE APYASLTQYL PYPSPTQKPI MTSNLQNMEN GEGHYLTHLN QSQALNDIPF  60
YYSQLHLSSN TSNSAIQIPL QKSSPNTSSN SNNNNAGEAK VLDDRKKKRM FSNRESARRS  120
RLRKKQQIEV LQYHVDHLQS LNHQLSQKVI YLLECNQQIH QQNAQLKDKV SSLQVALSDS  180
MVTTGNADIP HHNPNDFPTD PSTRPVETSR DFE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123RRSRLRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012573579.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027192752.11e-157basic leucine zipper 43
TrEMBLA0A3Q7YDZ61e-156A0A3Q7YDZ6_CICAR; basic leucine zipper 43
STRINGXP_004508736.11e-152(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.19e-29basic leucine-zipper 70