PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012573323.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GRF
Protein Properties Length: 390aa    MW: 44278.1 Da    PI: 7.4959
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012573323.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.71.1e-2477120144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  XP_012573323.1  77 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 120
                     79***************************************987 PP

2QLQ561.2e-19943236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FT++Q+q+L++Q+l+yKy+a++  +Pp+Ll+ i+
  XP_012573323.1  9 PFTPSQWQELEHQALVYKYMASGISIPPDLLFTIK 43
                    9******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-11844IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.1E-14942IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.797944IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9877121IPR014977WRC domain
PfamPF088791.4E-2078120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MMNGRNRYPF TPSQWQELEH QALVYKYMAS GISIPPDLLF TIKRSFLDSP LSSRMLPHQS  60
QHFGWNYLPM GLGRKIDPEP GRCRRTDGKK WRCSKEAYPD SKYCERHMHR GKNRSRKPVE  120
VLKTTTTNNT DAAASTILSI TKNSFLDPVD TTSSLVTPTT HETTSNYHHY NPHQHSSSSS  180
YSSSYHLQHS XLYHNNNPPP STSRPNSSLA FSFQDNNSAP LFLDSSSSHS NNNNNNTDCR  240
YVYGLKEEVD EHAFFTEPSG TMRSLSASSM DDSWQLTPLT ISSSSSSKQR SCSGLSNENE  300
YSYLQLQSLS DNNNNNSKQP HQDQSCYISG SDGKEEPQKI FHRFFDEWPP KSRNSWLDLD  360
DKSSTTQLSI SIPTSSHDFT TFSSTNQRDG
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012573323.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818063e-62LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
GenBankLN7132563e-62LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012573323.10.0growth-regulating factor 1-like isoform X2
TrEMBLA0A1S3ED350.0A0A1S3ED35_CICAR; growth-regulating factor 1-like isoform X2
STRINGXP_007154592.10.0(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-55growth-regulating factor 5