PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family VOZ
Protein Properties Length: 486aa    MW: 54755 Da    PI: 5.3532
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572680.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ423.24e-1302434591217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaf gpkcalwdc+rpaqg e +qdycss+h+ la neglpg+tp+lrp gid+kdg+lfaa+ ak+qgkevgip+cegaa++k+pwna+e+
  XP_012572680.1 243 PPPSAFRGPKCALWDCFRPAQGLEGCQDYCSSCHELLANNEGLPGMTPILRPYGIDVKDGPLFAAVLAKTQGKEVGIPKCEGAASTKAPWNASEF 337
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     fdls+l+get+rewlffdkprraf+sgnrkqrslpdysgrgwhesrkqvmke+gg+krsyymdpqp+s++ewhl+eyein+ d +alyrlelklv
  XP_012572680.1 338 FDLSFLDGETVREWLFFDKPRRAFDSGNRKQRSLPDYSGRGWHESRKQVMKEHGGQKRSYYMDPQPLSYLEWHLFEYEINNHDGCALYRLELKLV 432
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrlta 217
                     d+kks+kgkv+k+sl+dlq+k+g+lta
  XP_012572680.1 433 DKKKSPKGKVTKESLTDLQNKMGKLTA 459
                     *************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MMKENFNGKC GSSSHKSMKE KEKYLVDKIQ GIFSNIQLAR KESRANDIVI FEEQMHQLLR  60
EWQAELESPA TSLADGSLGS FTGDLAQLLQ AIEEKDDATS PLTKLVPLKN DLHQNNISDS  120
NYPFFQEKCF NNNQTLDHTF EGSASTLFNN PLNSSDMAQL HYHPFSLNQD MDHNTVGHNS  180
DLIGQFDFYH QDLSLGHNTE IKNSESAQFT FDEGFDCSQF LRDDDTAQFG ENHIPNILPS  240
IRPPPSAFRG PKCALWDCFR PAQGLEGCQD YCSSCHELLA NNEGLPGMTP ILRPYGIDVK  300
DGPLFAAVLA KTQGKEVGIP KCEGAASTKA PWNASEFFDL SFLDGETVRE WLFFDKPRRA  360
FDSGNRKQRS LPDYSGRGWH ESRKQVMKEH GGQKRSYYMD PQPLSYLEWH LFEYEINNHD  420
GCALYRLELK LVDKKKSPKG KVTKESLTDL QNKMGKLTAA FPSSDDGNPV KGKTDAKSED  480
IGPPEN
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012572680.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505530.10.0transcription factor VOZ1
RefseqXP_004505531.10.0transcription factor VOZ1
RefseqXP_012572680.10.0transcription factor VOZ1
RefseqXP_027191648.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-152VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1S3EA290.0A0A1S3EA29_CICAR; transcription factor VOZ1
STRINGXP_004505529.10.0(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-148vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]