PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572674.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 1728aa    MW: 195503 Da    PI: 5.977
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572674.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.51.9e-172175357
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    kR   t++qle+Le++++ ++yps+e r eL  klgL++rq ++WF+ rR k++k
  XP_012572674.1 21 KRKMKTASQLEILEKAYAAEPYPSEEFRVELCVKLGLSDRQLQMWFCHRRLKDRK 75
                    89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-17575IPR009057Homeodomain-like
PROSITE profilePS5007116.4551676IPR001356Homeobox domain
SuperFamilySSF466894.71E-151676IPR009057Homeodomain-like
SMARTSM003897.1E-141880IPR001356Homeobox domain
PfamPF000464.1E-152175IPR001356Homeobox domain
CDDcd000862.09E-122175No hitNo description
PROSITE profilePS5082717.031509568IPR018501DDT domain
SMARTSM005712.9E-22509568IPR018501DDT domain
PfamPF027912.5E-16510565IPR018501DDT domain
PfamPF050661.2E-13689756IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.9E-9902942IPR028942WHIM1 domain
PfamPF156134.9E-1210841156IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1728 aa     Download sequence    Send to blast
MENCSEVEKK KKPPEEENKV KRKMKTASQL EILEKAYAAE PYPSEEFRVE LCVKLGLSDR  60
QLQMWFCHRR LKDRKAVKTA ASISAPTVEG VEQIEIADVR HDHGLVSVLK LIDHDDLRRV  120
VPQHGMMAYP RMGAGLHAMD SSSSFHEPQL TILELRAIAF VERQLGEALR EDGPILGMEF  180
DSLPPGAFGA PLGVVSIGQH RESELPVEAK VYEHLNKGVS RTLHEYQFIP EQPTVRNEMY  240
ARVTTSIHFS SLDGVPHSGT TLSSGQSFLN GGNDDVPRKN PFVDVTLDTH RVADQVTPID  300
SPLVPSDRRV IHEEELSRFQ RKRKNEEARM QREFEAQEKR IRKELVKQDI LRQKREEQIK  360
KEMERQERER KKEEERLLRE RQREEERFLR EQRREQEQRE KFLQKESIRV ERLRQKEELR  420
REKEAARIKA SSERAIARRM AKESIDLIED EHLELMELAA SKKGLSSILA LDYETMQNLE  480
SYGDGRTSFP PKSVRLKKAF SIQPWSDSDE NVGNLLMVWR FLITFADVLG IWPFTLDELL  540
QAFHDYDPRI LGEIHIALLR SILKDIEDVA RTPTTGLGAN QNNITNSGGG HPQVVEGAYV  600
WGFDIRNWQW HLNPLTWPEI LRQFALSAGF GPLMKKQNIE QVHPCNEGND GKDIISNLRS  660
GAAVENAVAI MQEKGLPNRR TYRPRLTPGT VKYAAFHVLS LEGSRGLNIL ELADKIQKSG  720
LRDLTTSKAP EASIASALSR DTKLFERTAP STYCVRPAYR KDPADSEAIY SAAREKIRVF  780
KSGFVGAEEA DDGERDENSE SDMAENHEID DLGAETNTKK EVSNSEKFNA NTVMRNGKDN  840
GEGFQTPDSC HEKVDEGLAS TVDEGFNKHK DVHTSSEIAV CSHDVTNPIL EGMDVDENTL  900
GEPWAQGLME GEYSDLSVEE RLHALVALIN VAIEGNSIRL ILEERLEAAN TLKKQIWAEA  960
QLDKRRIKDD CFVKLQSFSY LGNKNEPAVT FPSVEGKQCP LHTVHVKIDK ASVTPYDQHE  1020
QINALQGNQN HLQSSLLDVN IQRQDCPTGP DNCSLQQSGY VAEKSRSNFK SYIGHLAEQT  1080
YMYRSLPLGL DRRRNRYWQF ITSASQNDPG CGRIFVELHD GCWKLIDSEE GFDALLASLD  1140
LRGIRESHLH MMLQRIEMSY KNSVRRNVQN GDMGIQNGDT MKKLKTETVK MGTDQDCSAT  1200
SVYVDDLDTS VTSTSFMVQL GRNEVENKDA YMRYWDFEKW MQKQCLNCSV SFAMKFGKKR  1260
CNQLLLMCDL CHRVYFSRGT PSPCPSCHRT STSQDNSSSY ECIARSEGKR KIGTHLFNHP  1320
SSSPFRMRLL KILLSVVEVT LPQEALQPFW TERYRKSWSS KLEASSSPED ILQTLTALEG  1380
AIKREYLAPD YETTSELLGT VCSSGCLPND TIGGGQIPVL PWVPYTTAAV ALRLMELDAC  1440
IFYTSQQKLE SEKDKKNGVV IKLPSKYAAA KNSYNASVIE TSFQAKHAVE NLGALGAGLE  1500
SYSRGQRTRL GRGHSHGQRS QGRVSSSRPT SRKRSTTSNN RKIGKLLGWK GRPNGQGQFC  1560
GRRSIRSWQK PAAKTDVLNS KRDTRNVIKE KTPIFVREEI NESKTEASAL NARNSETSDN  1620
EEDLYQATGD EYDYLVGNNN NGGYQGGFCG KSDNLIEQSH YILDDEEDGD MDNDDNVNDD  1680
KEDGQVDLNV EDYIIGEDSK DAGYNREIIA EQNEEPDGVF STSSDYID
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012572674.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1515270.0AC151527.13 Medicago truncatula clone mth2-135i19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572674.10.0homeobox-DDT domain protein RLT2 isoform X7
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A1S3EBC80.0A0A1S3EBC8_CICAR; homeobox-DDT domain protein RLT2 isoform X7
STRINGXP_004505537.10.0(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator