PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 1740aa    MW: 196780 Da    PI: 5.9368
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572673.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.52e-172175357
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    kR   t++qle+Le++++ ++yps+e r eL  klgL++rq ++WF+ rR k++k
  XP_012572673.1 21 KRKMKTASQLEILEKAYAAEPYPSEEFRVELCVKLGLSDRQLQMWFCHRRLKDRK 75
                    89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-17575IPR009057Homeodomain-like
PROSITE profilePS5007116.4551676IPR001356Homeobox domain
SuperFamilySSF466894.71E-151676IPR009057Homeodomain-like
SMARTSM003897.1E-141880IPR001356Homeobox domain
CDDcd000861.99E-122175No hitNo description
PfamPF000464.2E-152175IPR001356Homeobox domain
SMARTSM005712.9E-22521580IPR018501DDT domain
PROSITE profilePS5082717.031521580IPR018501DDT domain
PfamPF027912.5E-16522577IPR018501DDT domain
PfamPF050661.2E-13701768IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.9E-9914954IPR028942WHIM1 domain
PfamPF156134.9E-1210961168IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1740 aa     Download sequence    Send to blast
MENCSEVEKK KKPPEEENKV KRKMKTASQL EILEKAYAAE PYPSEEFRVE LCVKLGLSDR  60
QLQMWFCHRR LKDRKAVKTA ASISAPTVEG VEQIEIADVR HDHGLVSVLK LIDHDDLRRV  120
VPQHGMMAYP RMGAGLHAMD SSSSFHEPQL TILELRAIAF VERQLGEALR EDGPILGMEF  180
DSLPPGAFGA PLGVVSIGQH RESELPVEAK VYEHLNKGVS RTLHEYQFIP EQPTVRNEMY  240
ARVTTSIHFS SLDGVPHSGT TLSSGQSFLN GNEFAPNVYG VQGGNDDVPR KNPFVDVTLD  300
THRVADQVTP IDSPLVPSDR RVIHEEELSR FQRKRKNEEA RMQREFEAQE KRIRKELVKQ  360
DILRQKREEQ IKKEMERQER ERKKEEERLL RERQREEERF LREQRREQEQ REKFLQKESI  420
RVERLRQKEE LRREKEAARI KASSERAIAR RMAKESIDLI EDEHLELMEL AASKKGLSSI  480
LALDYETMQN LESYGDGRTS FPPKSVRLKK AFSIQPWSDS DENVGNLLMV WRFLITFADV  540
LGIWPFTLDE LLQAFHDYDP RILGEIHIAL LRSILKDIED VARTPTTGLG ANQNNITNSG  600
GGHPQVVEGA YVWGFDIRNW QWHLNPLTWP EILRQFALSA GFGPLMKKQN IEQVHPCNEG  660
NDGKDIISNL RSGAAVENAV AIMQEKGLPN RRTYRPRLTP GTVKYAAFHV LSLEGSRGLN  720
ILELADKIQK SGLRDLTTSK APEASIASAL SRDTKLFERT APSTYCVRPA YRKDPADSEA  780
IYSAAREKIR VFKSGFVGAE EADDGERDEN SESDMAENHE IDDLGAETNT KKEVSNSEKF  840
NANTVMRNGK DNGEGFQTPD SCHEKVDEGL ASTVDEGFNK HKDVHTSSEI AVCSHDVTNP  900
ILEGMDVDEN TLGEPWAQGL MEGEYSDLSV EERLHALVAL INVAIEGNSI RLILEERLEA  960
ANTLKKQIWA EAQLDKRRIK DDCFVKLQSF SYLGNKNEPA VTFPSVEGKQ CPLHTVHVKI  1020
DKASVTPYDQ HEQINALQGN QNHLQSSLLD VNIQRQDCPT GPDNCSLQQS GYVAEKSRSN  1080
FKSYIGHLAE QTYMYRSLPL GLDRRRNRYW QFITSASQND PGCGRIFVEL HDGCWKLIDS  1140
EEGFDALLAS LDLRGIRESH LHMMLQRIEM SYKNSVRRNV QNGDMGIQNG DTMKKLKTET  1200
VKMGTDQDCS ATSVYVDDLD TSVTSTSFMV QLGRNEVENK DAYMRYWDFE KWMQKQCLNC  1260
SVSFAMKFGK KRCNQLLLMC DLCHRVYFSR GTPSPCPSCH RTSTSQDNSS SYECIARSEG  1320
KRKIGTHLFN HPSSSPFRMR LLKILLSVVE VTLPQEALQP FWTERYRKSW SSKLEASSSP  1380
EDILQTLTAL EGAIKREYLA PDYETTSELL GTVCSSGCLP NDTIGGGQIP VLPWVPYTTA  1440
AVALRLMELD ACIFYTSQQK LESEKDKKNG VVIKLPSKYA AAKNSYNASV IETSFQAKHA  1500
VENLGALGAG LESYSRGQRT RLGRGHSHGQ RSQGRVSSSR PTSRKRSTTS NNRKIGKLLG  1560
WKGRPNGQGQ FCGRRSIRSW QKPAAKTDVL NSKRDTRNVI KEKTPIFVRE EINESKTEAS  1620
ALNARNSETS DNEEDLYQAT GDEYDYLVGN NNNGGYQGGF CGKSDNLIEQ SHYILDDEED  1680
GDMDNDDNVN DDKEDGQVDL NVEDYIIGED SKDAGYNREI IAEQNEEPDG VFSTSSDYID
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012572673.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1515270.0AC151527.13 Medicago truncatula clone mth2-135i19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572673.10.0homeobox-DDT domain protein RLT2 isoform X6
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A1S3EB790.0A0A1S3EB79_CICAR; homeobox-DDT domain protein RLT2 isoform X6
STRINGXP_004505537.10.0(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator